Polypeptides and composition thereof for treating metabolic system diseases
A composition and mixture technology, applied in the field of biomedicine, can solve problems such as hypoglycemia, nausea and vomiting of patients, and bone loss, and achieve long-term stable storage, excellent hypoglycemic and blood lipid-lowering activities, and convenient and safe medication
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0151] Embodiment 1 extracts polypeptide of the present invention from leguminous plant
[0152] The polypeptides of the present invention can be extracted from the seeds of leguminous plants or soybean meal, a by-product of processing. The specific extraction process is as follows:
[0153] Take 10 kg of commercial pea soybean meal, pulverize it with a pulverizer, and sieve it to obtain particles with an average particle size of 100 mesh, mix it with 50 liters of chloroform, stir for 1 hour, centrifugally filter, wash the filter cake with chloroform, and obtain decolorized and degreased soybean meal after drying.
[0154] The above-mentioned decolorized and defatted soybean meal was mixed with 100 liters of n-butanol, homogenized by a homogenizer for 30 minutes, connected to a freezer to control the working temperature at 10°C, then transferred to a jacketed extraction tank, stirred for 24 hours at 10°C, and centrifuged to obtain The supernatant, the filter cake was washed w...
Embodiment 2
[0171] Embodiment 2 Utilizes the solid-phase polypeptide synthesis method to synthesize the polypeptide of the present invention
[0172] The polypeptide of the present invention can also be synthesized by a solid-phase polypeptide synthesis method, and the specific process is as follows:
[0173] Use the ABI 433A type peptide synthesizer of Applied Biosystems, adopt the Fmoc / tBu method, NMP solvent system, HBTU / HOBt as the condensation agent, the groups used to protect the amino acid side chains are: Ser, Thr and Tyr use tert-butyl (tBu ), Asp and Glu use tert-butyl ester group, Asn, Gln and Cys use trityl (Trt), Arg uses 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfone Acyl (Pbf), Lys uses 2-chlorobenzyloxycarbonyl. The synthesis scale is 0.5 mmol, and the amino acid with protective group and condensing agent are in excess of 10 times, and it is automatically completed after the program is set. After the reaction was completed, the resin was washed three times with DCM, va...
Embodiment 3
[0189] Example 3 Normal mouse tail vein injection polypeptide hypoglycemic effect experiment of the present invention
[0190] 1. Materials and Instruments
[0191] Polypeptide: the polypeptide of SEQ ID No.7 in embodiment 1, average molecular weight 3789, aminoacid sequence is ASCNGVCSPFEMPPCGTSACCRCIPVGLFIGYCRNPSG (see figure 2 ), HPLC purity ≥ 98%, is prepared into the solution of 1mg / ml with normal saline for subsequent use;
[0192] Kunming white mice: Hubei Provincial Health and Epidemic Prevention Station, 40, weighing 20±2g, male;
[0193] Blood glucose tester and test strips: Beijing Yicheng Medical Co., Ltd.;
[0194] 2. Experimental method
[0195] The above-mentioned mice were fasted for 4 hours (without water) and randomly divided into 4 groups, 10 mice in each group. Each mouse was stained with picric acid as a marker, and the tail vein blood was taken to measure blood sugar. The blank control group was given normal saline 0.05ml / 10g rat tail vein injection ...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap