Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A secreted fndc5 protein and its preparation method and application

A secreted protein technology, applied in the field of genetic engineering, to achieve the effect of easy access, simple structure, and improvement of glucose and insulin tolerance

Active Publication Date: 2020-12-29
THE SECOND HOSPITAL OF SHANDONG UNIV
View PDF2 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] Directly secreted FNDC5 isoforms without a transmembrane domain and their use in lipid metabolism have not been reported so far

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A secreted fndc5 protein and its preparation method and application
  • A secreted fndc5 protein and its preparation method and application
  • A secreted fndc5 protein and its preparation method and application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment

[0026] A secreted FNDC5 amino acid sequence is shown in SEQ ID NO: 1;

[0027] MPPGPCPRAALRLWLGCVCFALVQADAPVNVTVRHLKANSAVVSWDVLEDEGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNEVPFANVDDTGKHNQRAALQNAEGAKA;

[0028] Preparation method of secreted FNDC5 protein:

[0029] (1) Design primers from different sites of the fndc5 gene, perform PCR, run electrophoresis, and detect other isomers besides the known fndc5 isomers; specifically,

[0030] Primers are:

[0031] Upstream primer FNDC5-F: TGAGGCCGAGAAGATGGCCTCTAA;

[0032] Downstream primer FNDC5-R: TAGTGACAATGGCTGCTCTCTGCC;

[0033] Extract INS-1 cell RNA, reverse transcribe into cDNA, and use the above primers for PCR.

[0034] PCR reaction system: H 2 O:36.75ul

[0035] Go Taq DNA Polymerase: 0.25ul (Promega)

[0036] 5x Go Taq Buffer: 10ul (Promega)

[0037] FNDC5-F: 1ul

[0038] FNDC5-R: 1ul

[0039] cDNA: 1ul

[0040] Total 50ul

[0041] 94°C for 5 minutes;

[0042] 94°C for 30 seconds,...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a secretion-type FNDC5 protein. The secretion-type FNDC5 protein does not contain a transmembrane domain and can be directly secreted and released into blood; and the amino acid sequence of the FNDC5 protein is SEQ ID NO:1. The secretion-type FNDC5 protein is simple in structure and convenient to obtain. The secretion-type FNDC5 protein can be used for treating obesity-related metabolic disorders; after the secretion-type FNDC5 recombinant protein is injected into the abdominal cavity of a high-fat fed obese mouse model, glucose and insulin tolerance can be effectivelyimproved, and it shows that the protein can obviously relieve glucose metabolic disorders and insulin resistance of obese patients; and fatty liver occurrence can be obviously relieved, the level of plasma cholesterol, free fatty acid and triglyceride is decreased, and it shows that the protein can relieve the lipometabolic disorders of the obese patients. The secretion-type FNDC5 protein can serve as a new drug target for treating the metabolic disease to be developed.

Description

technical field [0001] The invention relates to the technical field of genetic engineering, in particular to a secreted FNDC5 protein and its preparation method and application. Background technique [0002] Obesity is a common metabolic disease that threatens the health of people all over the world. Obese patients are more likely to develop cardiovascular and cerebrovascular diseases, type 2 diabetes, respiratory distress syndrome and musculoskeletal diseases. The energy intake of the human body is higher than the energy consumption, and the remaining calories will be stored in the body in the form of adipose tissue. When the content of adipose tissue exceeds the physiological needs, it will evolve into obesity. Therefore, increasing energy expenditure has gradually become a powerful means for the potential prevention and treatment of obesity and its related diseases. [0003] Irisin, a protein with 112 amino acid residues discovered in 2012, is the product of cleavage of ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C07K14/575C12N15/81A61K38/22A61P3/04C12R1/84
CPCA61K38/00A61P3/04C07K14/575C12N15/815
Inventor 唐东起李世武李慧
Owner THE SECOND HOSPITAL OF SHANDONG UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products