Preparation method of semaglutide
A semaglutide and preparation technology, applied in the field of semaglutide preparation, can solve the problems of reducing product yield, increasing production cost, resin polycondensation, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0161] The preparation of semaglutide is to use genetic recombination technology to obtain the semaglutide precursor whose 17th or 18th position is Boc-protected lysine, and then connect the semaglutide side chain tBuO-Ste-Glu (AEEA-AEEA- OSu)-OtBu, thereby obtaining semaglutide.
[0162] Preparation of semaglutide
[0163] The present invention provides two synthetic routes of semaglutide, which are respectively as follows, the Fmoc complex modified compound 2 is prepared from the Boc-semaglutide precursor (compound 1), and the compound 2 is obtained after de-Boc protection 3. Compound 3 was reacted with activated semaglutide side chain tBuO-Ste-Glu(AEEA-AEEA-OSu)-OtBu to obtain compound 4, and then compound 5 was obtained by removing the Fmoc reaction, and the side chain removed the tBu protecting group , and finally semaglutide compound 6 was obtained.
[0164]
[0165]
[0166] Specifically, the present invention provides a method for preparing semaglutide, the met...
Embodiment 1
[0178] Embodiment 1 Construction of semaglutide expression strain
[0179] The construction of the semaglutide expression plasmid refers to the description in the example in the patent application number 201910210102.9. The DNA fragment of fusion protein FP1-TEV-EK-GLP-1 (18) or FP2-TEV-EK-GLP-1 (17) was cloned into the expression vector plasmid pBAD / His A (purchased from NTCC Company, Kanamyces The downstream NcoI-XhoI site of the araBAD promoter of protein resistance) was used to obtain the plasmid pBAD-FP1-TEV-EK-GLP-1 (18) or pBAD-FP2-TEV-EK-GLP-1 (17). Plasmid map such as figure 1 , as shown in 2.
[0180] Fusion protein 1 and fusion protein 2 were constructed based on the semaglutide precursor with 2-5 amino acids missing from the N-terminus shown in SEQ ID NO:1 or SEQ ID NO:2
[0181] The amino acid sequence of fusion protein 1 is shown in SEQ ID NO:4:
[0182] MVSKGEELFTGV KLTLKFICTTYVQERTISFKDTYKTRAEVKFEGD ENLYFQGDDDDKEGTFTSDVSSYLEGQAA K EFIAWLVRGRG
[0183]Th...
Embodiment 2B
[0197] Embodiment 2 Expression of Boc-semaglutide precursor
[0198] Two kinds of recombinant Escherichia coli seed solutions were respectively inoculated into the fermentation medium according to the inoculum amount of 5%, cultured in batches at 37°C and pH 7.0 until the pH rose to 7.05, and the carbon and nitrogen sources were fed separately. The carbon and nitrogen source flow-feeding method is used. After feeding, 7.5M ammonia water is automatically added, and the pH is controlled at 7.0-7.2. Cultivate for 4-6 hours, add L-arabinose to induce, and continue to induce for 14±2h. Two fermentation broths containing the semaglutide precursor fusion protein were obtained.
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com