Recombinant elastin and production thereof
A fluorescent protein and protease cleavage technology, which is applied in the field of recombinant elastin and its production, can solve problems such as difficult extraction of elastin
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 125
[0125] Example 1.25kDa truncated human elastin
[0126] Non-naturally occurring truncated human elastin without a His-tag, linker and / or thrombin cleavage site is disclosed below. The non-naturally occurring truncated human elastin is truncated relative to full length human elastin (SEQ ID NO: 20). The codon-optimized nucleotide and amino acid sequences encoding this elastin are disclosed below. In SEQ ID NO:4, the DsbA secretion tag is encoded by nucleotides 1-57 and encodes amino acids 1-19 of SEQ ID NO:5. In SEQ ID NO:4, the non-naturally occurring truncated human elastin sequence is encoded by nucleotides 58-927 and encodes amino acids 20-309 of SEQ ID NO:5.
[0127] The codon-optimized nucleotide sequence encoding the non-naturally occurring truncated elastin is provided in SEQ ID NO:4.
[0128] ATGAAAAAGATTTGGCTGGCGCTGGCTGGTTTAGTTTTAGCGTTTAGCGCATCGGCGGGTCCGCAACCTGGGGTTCCGTTAGGTTATCCGATTAAAGCACCGAAACTGCCCGGCGGTTATGGTCTGCCGTACACAACCGGTAAACTGCCGTATGGTTATGGCCCGGGTGGAGTT...
Embodiment 3
[0160] Example 3. 60kDa truncated human elastin
[0161] The amino acid sequence of a 60.3 kDa non-naturally occurring truncated human elastin internally truncated relative to full-length human elastin (SEQ ID NO:20) is disclosed in SEQ ID NO:10. The 60.3 kDa non-naturally occurring truncated human elastin has amino acids 461-527 deleted from full length human elastin (SEQ ID NO: 20).
[0162] GGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPGVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGAAGAGVLGGLVPGPQAAVPGVPGTGGVPGVGTPAAAAKSAAKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAGADEGVRRSLSPELREGDPSSSQHLPSTPSSPRVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPA...
Embodiment 4
[0166] Example 4. Effect of Truncated Elastin on Fibroblast Viability, Tropocollagen Synthesis and Tropoelastin Synthesis ring
[0167] Human fibroblast cultures were used to assess the ability of the non-naturally occurring truncated human elastin molecules of Example 1 to affect tropoelastin and tropoelastin synthesis. Human fibroblast cultures were also used to determine the viability of human fibroblasts after exposure to truncated elastin.
[0168] A 2% w / w stock solution of truncated elastin was prepared from the truncated elastin of Example 1. Aliquots from the 2% truncated elastin stock solution were then used in the experiments described below.
[0169] Preparation of fibroblasts
[0170] Seed fibroblasts in 0.5 mL of fibroblast growth medium (FGM) in each well of a 24-well plate and incubate at 37 ± 2 °C and 5 ± 1% CO 2 Incubate overnight. The next day, remove the medium by aspiration to eliminate any non-adherent cells and replace with 0.5 mL of fresh FGM. ...
PUM
| Property | Measurement | Unit |
|---|---|---|
| molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 


