Nuclide-labeled inhibitory peptide as well as preparation method and application thereof

A technology for inhibiting peptides and nuclides, applied in the field of tumor prognosis, can solve problems such as adverse events, and achieve the effects of low radiation dose, good biocompatibility, and good stability

Active Publication Date: 2022-08-09
SUZHOU UNIV
View PDF5 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Immunotherapy has become an important means of cancer treatment today, but in fact only a small number (less than 20%) of patients can benefit from anti-PD-1 / PD-L1 immunotherapy, and 20-40% of these patients develop serious adverse event

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Nuclide-labeled inhibitory peptide as well as preparation method and application thereof
  • Nuclide-labeled inhibitory peptide as well as preparation method and application thereof
  • Nuclide-labeled inhibitory peptide as well as preparation method and application thereof

Examples

Experimental program
Comparison scheme
Effect test

preparation example Construction

[0044] The present invention also provides a method for preparing the nuclide-labeled inhibitory peptide, comprising the following steps:

[0045] (1) Mix the DOTA-coupled ASF1a peptide with the nuclide solution to obtain a mixed solution, mix the mixed solution with sodium acetate, adjust the pH, and take a water bath to obtain a reaction solution;

[0046] (2) Pass the reaction solution obtained in step (1) through a chromatographic column to collect the product.

[0047] In the present invention, the nuclide solution in step (1) is 68 GaCl 3 solution or 177 LuCl 3 / HCl solution; preferably 68 GaCl 3 solution.

[0048] In the present invention, step (1) is described 68 GaCl 3 solution or 177 LuCl 3 The radiation dose of the / HCl solution is independently 111 to 185 MBq; preferably 121 to 175 MBq; more preferably 131 to 165 MBq; more preferably 145 MBq.

[0049] In the present invention, the 68 GaCl 3 The preparation method of the solution is: rinsing with hydroc...

Embodiment 1

[0069] Synthesis of ASF1aPeptide, AP1

[0070] (1) Estimate the feeding amount of each amino acid according to the weight and molecular weight of the target polypeptide, and each amino acid and DOTA use protective raw materials.

[0071] (2) put 2-Cl(Trt)-Cl resin into 150mL reactor, and add 80mL DCM to soak for 2 hours;

[0072] (3) The resin was washed with DMF, and then drained. This was repeated 4 times to drain the resin.

[0073] (4) Weigh Fmoc-Ala-OH (the first amino acid at the C-terminal, CAS No. 154445-77-9) + 80 mL of DCM and DIEA into the reactor, and then place the reactor in a shaker at 30°C reaction for 2 hours;

[0074] (5) Add 0.5 mL of DIEA and 0.5 mL of methanol with a pipette, react for 20 min, and block unreacted groups on the resin.

[0075] (6) add an appropriate volume ratio of 20% piperidine solution (piperidine / DMF=1:4) into the reactor, which is 3 times the volume of the resin, react for 20min, remove the Fmoc protecting group, and use DMF washed...

Embodiment 2

[0085] A nuclide-labeled inhibitory peptide, the nuclide-labeled inhibitory peptide is converted to 68 Ga-labeled ASF1a peptide; the amino acid sequence of the ASF1a peptide is YGRKKRRQRRRCASTEEKWARLARRIAGAGGVTLDGFGGCA;

[0086] The preparation method of the nuclide-labeled inhibitory peptide, the steps are as follows:

[0087] (1) Rinse with 4 mL of 0.05M hydrochloric acid 68 Ge- 68 Ga generator (flow rate is 0.8mL / min), collect the 2~3mL intermediate product 68 GaCl 3 ;

[0088] (2) 15 μL of DOTA-conjugated ASF1a peptide (at a concentration of 1 mg / mL) was mixed with 1 mL 68 GaCl 3 The solution (radiation dose of 111MBq) was mixed to obtain a mixed solution, the mixed solution was mixed with 250 μL of sodium acetate (concentration of 0.23M), the pH was adjusted to 3.8, and the reaction solution was obtained in a metal bath at 93°C for 8 minutes;

[0089] (3) 5 mL of 70% ethanol was used to activate the C18 cartridge dropwise, rinsed with 5 mL of normal saline, and the...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to the technical field of tumor prognosis, in particular to a nuclide-labeled inhibitory peptide as well as a preparation method and application thereof. According to the nuclide-labeled inhibitory peptide disclosed by the invention, 68Ga / 177Lu is labeled with ASF1a peptide through DOTA; the amino acid sequence of the ASF1a peptide is YGRKRRQRRRCASTEEKWARLARRIAGGVLDGFGGCA, and the amino acid sequence of the ASF1a peptide is According to the 68Ga-labeled ASF1a inhibitory peptide disclosed by the invention, the expression level of tumor ASF1a is displayed through PET / CT imaging, the imaging sensitivity is good, high-expression and low-expression individuals can be specifically screened, and the curative effect of noninvasive prediction of tumor immunotherapy is realized. The 177Lu-labeled ASF1a inhibitory peptide provides a new effective treatment strategy for tumors which highly express ASF1a and are ineffective in immunotherapy.

Description

technical field [0001] The invention relates to the technical field of tumor prognosis, in particular to a radionuclide-labeled inhibitory peptide and a preparation method and application thereof. Background technique [0002] In recent years, immunotherapy has revolutionized the field of cancer research by harnessing the power of the immune system to fight cancer. Immunotherapy has become an important means of cancer treatment today, but in fact only a small number (less than 20%) of patients can benefit from anti-PD-1 / PD-L1 immunotherapy, and 20-40% of these patients develop serious adverse events. Identifying which patients are more likely to benefit from immune checkpoint blockade (ICB) and maximize efficacy and minimize toxicity is important. [0003] ASF1a promotes the suppression of tumor immunity. ASF1a is overexpressed in various primary human tumors including melanoma, LUAD. Studies have shown that high expression of ASF1a is associated with significantly poore...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/47C07K1/13C07K1/16A61K51/08A61P35/00A61P35/04A61K103/30A61K103/00
CPCC07K14/4703A61K51/08A61P35/00A61P35/04Y02P20/55C07B59/008A61K51/088A61K2121/00A61K2123/00C07B2200/05C07K1/20
Inventor杨凯施秀敏
OwnerSUZHOU UNIV