Supercharge Your Innovation With Domain-Expert AI Agents!

Use of Dayan peptide/inflammation factor/in preparing tag diagnosing mammary cancer

A technology of inflammatory factors and breast cancer, which is applied in the field of markers for the diagnosis of breast cancer, can solve problems such as misdiagnosis, failure to identify breast cancer, and doctors' inability to obtain correct judgments

Inactive Publication Date: 2006-06-07
HUAZHONG UNIV OF SCI & TECH
View PDF0 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, HE staining can only be used for advanced tumors, so when the tumor cells have complete and obvious morphological characteristics of cancer cells, the disease has reached a level that is difficult to cure
At the same time, some cells with normal physiological status may also have abnormal morphology, and doctors cannot get correct judgments, and even cause misdiagnosis
So far, there is no exact and specific marker for breast cancer

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Use of Dayan peptide/inflammation factor/in preparing tag diagnosing mammary cancer
  • Use of Dayan peptide/inflammation factor/in preparing tag diagnosing mammary cancer
  • Use of Dayan peptide/inflammation factor/in preparing tag diagnosing mammary cancer

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0017] 1. Preparation of large inflammatory peptides

[0018] (1) Purification of large inflammatory peptides from natural materials

[0019] Using pig small intestine as raw material (500 kg), boil water for 10 minutes to inactivate endogenous protease. After low-temperature leaching with 0.2M dilute acetic acid for 10 hours, alginic acid (5 kg) was adsorbed, salted out with 320g / L sodium chloride, the salted out product was collected by filtration, fractional extraction with isopropanol, dextran Sephadex G-25 gel Filtration and cellulose weak anion DEAE exchange column chromatography, and finally separated and purified Dayanpeptide by reversed-phase high-performance liquid chromatography. Dayanpeptide is a white powder, easily soluble in water, with a molecular weight of 17,000 Daltons.

[0020] (2) Prepared by genetic engineering

[0021] Design a pair of primers as follows:

[0022] 5'GCGAATTCTATGAGCCAAACCAGGGATT 3'

[0023] 5'GCCTGCATTTCCCATATCTGGGTATTAG 3'

[0024]...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention relates to application of macro inflammatory peptide / inflammatory factor 1 in preparing marker for diagnosing mammary cancer, and aims at providing mammary cancer diagnosis with determined specific marker. The macro inflammatory peptide / inflammatory factor 1 have the amino acid sequence of: SQTRDLQGGKAFRLLKAQQEERLDEINK QFLDDPKYSSDEDLPSDLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP, is white powder and water soluble, and has molecular weight of 17 KDa. The macro inflammatory peptide / inflammatory factor 1 is used as used as antigen in preparing monoclonal and polyclonal antibody through standardized process for mammary cancer diagnosis. The present invention has mammary tumor diagnosing effect not inferior to HE process and may obtain result more precise than that of HE process.

Description

technical field [0001] The invention belongs to cancer diagnosis markers, and in particular relates to preparing monoclonal or polyclonal antibodies with polypeptide (big inflammatory peptide / inflammatory factor 1) Daintain / AIF1 as a marker for diagnosing breast cancer. Background technique [0002] At present, the diagnosis of breast cancer mainly depends on the patient's clinical response and tumor appearance characteristics to make a preliminary judgment. However, whether it is a malignant tumor must be distinguished from the cytological level, and the world-recognized eosin / hematoxylin (HE) pathological section is generally used for diagnosis. However, HE staining can only be used for advanced tumors, so when the tumor cells have complete and obvious morphological characteristics of cancer cells, the disease has reached a level that is difficult to cure. At the same time, some cells with normal physiological status may also have abnormal morphology, which makes doctors ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): G01N33/532C07K16/00G01N33/577
Inventor 陈正望李发芳赵燕英王建和陈磊
Owner HUAZHONG UNIV OF SCI & TECH
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More