Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

62 results about "Mammary tumor" patented technology

A mammary tumor is a neoplasm originating in the mammary gland. It is a common finding in older female dogs and cats that are not spayed, but they are found in other animals as well. The mammary glands in dogs and cats are associated with their nipples and extend from the underside of the chest to the groin on both sides of the midline. There are many differences between mammary tumors in animals and breast cancer in humans, including tumor type, malignancy, and treatment options. The prevalence in dogs is about three times that of women. In dogs, mammary tumors are the second most common tumor (after skin tumors) over all and the most common tumor in female dogs with a reported incidence of 3.4%. Multiple studies have documented that spaying female dogs when young greatly decreases their risk of developing mammary neoplasia when aged. Compared with female dogs left intact, those spayed before puberty have 0.5% of the risk, those spayed after one estrous cycle have 8.0% of the risk, and dogs spayed after two estrous cycles have 26.0% of the risk of developing mammary neoplasia later in life. Overall, unspayed female dogs have a seven times greater risk of developing mammary neoplasia than do those that are spayed. While the benefit of spaying decreases with each estrous cycle, some benefit has been demonstrated in female dogs even up to 9 years of age. There is a much lower risk (about 1 percent) in male dogs and a risk in cats about half that of dogs.

Prospective identification and characterization of breast cancer stem cells

Human breast tumors contain hetrogeneous cancer cells. using an animal xenograft model in which human breast cancer cells were grown in immunocompromised mice we found that only a small minority of breast cancer cells had capacity to form new tumors. The ability to form new tumors was not a slochastic property, rather certain populations of cancer cells were depleted for the ability to form new tumors, while other populations were enriched for the ability to form new tumors. Tumorigenic cells could be distinguished from non-tumorigenic cancer cells based on surface marker expression. We prospectively identified and isolated the tumorigenic cells as CD4430CD24− / lowLINEAGE A few as 100 cells from this population were able to form tumors the animal xenograft model, while tens of thousands of cells from non-tumorigenic populations failed to form tumors. The tumorigenic cells could be serially passaged, each time generating new tumors containing and expanded numbers of CD44+CD24 Lineage tumorigenic cells as well as phenotypically mixed populations of non-tumorigenic cancer cells. This is reminiscent of the ability of normal stem cells to self-renew and differentiate. The expression of potential therapeutic targets also differed between the tumorigenic and non-tumorigenic populations. Notch activation promoted the survival of the tumorigenic cells, and a blocking antibody against Notch 4 induced tumorigenic breast cancer cells to undergo apoptosis.
Owner:RGT UNIV OF MICHIGAN

Mammary gland affection quantification image evaluation system and using method thereof

The invention provides a quantitative image evaluation system of breast lesions and an application method thereof. The quantitative image evaluation system adopts fractal technology and graphic analysis in tumor medical image analysis and tumor hazard rate evaluation, establishes and adopts a nonlinear data model for growth and diffusion of breast lesion cells. The nonlinear data model comprises morphological characteristic parameters of growth, diffusion and calcification of mammary tumor cells and clinical parameters as well. The quantitative image evaluation system of breast lesions of the invention adopts the nonlinear data model for growth and diffusion of breast lesion cells and comprises the morphological characteristic parameters of growth, diffusion and calcification of mammary tumor cells and the clinical parameters as well, calculates predictive values of benign and malignant breast lesions by mammography and predictive values of tumor cell classification; therefore, the quantitative image evaluation system can be widely used in mammography diagnosis and mammography screening.
Owner:李立

Reconstituted human breast tumor model

A reconstituted human breast tumor model is disclosed. The model, which is incorporated into mice, provides actual tumors that arise spontaneously, thereby mimicking naturally occurring breast cancer. The tumors are genetically human, because they arise from human mammary tissues that develop from human mammary epithelial cells implanted into host mice. Prior to implantation, the mammary epithelial cells are genetically modified to contain a recombinant human oncogene and an SV40 early region.
Owner:AVEO PHARM INC

Mammary stem cell marker

It is disclosed here that low density lipoprotein receptor-related protein 5 (LRP5) is a cell surface marker for somatic mammary stem cells and mammary tumor stem cells. The disclosure here provides new tools for enriching somatic mammary stem cells and mammary tumor stem cells. Methods of screening for agents that modulate LRP5 activity, of treating mammary tumor or breast cancer, of monitoring somatic mammary stem cells and mammary tumor stem cells in vivo are also provided, and of assessing prognosis of human breast cancer.
Owner:VAN ANDEL RES INST +1

Application of traditional Chinese drug Zengshengping to treating mammary gland tumor

The invention relates to application of a Chinese materia medica preparation, in particular to application of a traditional Chinese drug Zengshengping to treating mammary gland tumor. Achievements ofexperimental investigation accidentally disclose that zengshengping has good effect on treating the mammary gland tumor, galactocele, normal hyperplasia of mammary glands and atypical hyperplasia of mammary glands.
Owner:TIANJIN PRECEDE MEDICAL TRADE

Radio-frequency electrical membrane breakdown for the treatment of high risk and recurrent prostate cancer, unresectable pancreatic cancer, tumors of the breast, melanoma or other skin malignancies, sarcoma, soft tissue tumors, ductal carcinoma, neoplasia, and intra and extra luminal abnormal tissue

An imaging, guidance, planning and treatment system integrated into a single unit or assembly of components, and a method for using same, that can be safely and effectively deployed to treat prostate cancer in all medical settings, including in a physician's office or in an outpatient setting. The system utilizes the novel process of Radio-Frequency Electrical Membrane Breakdown (“EMB” or “RFEMB”) to destroy the cellular membranes of unwanted or cancerous tissue without denaturing the intra-cellular contents of the cells comprising the tissue, thereby exposing tumor antigens and other intra-cellular components which can have an immunologic effect on local or distant cancerous tissue, with or without the addition of immunologic adjutant drugs. The system preferably comprises at least one EMB treatment probe 20, at least one trackable biopsy needle 200, at least one trackable anesthesia needle 300, and at least one controller unit for at least partially automating the treatment process.
Owner:IMMUNSYS INC

Application of 5alpha-8alpha-ergosterol peroxide-6,22(E)-diene-3beta-alcohol to preparation of anti-tumor drug

The invention belongs to the field of medicine, and particularly relates to the application of 5alpha-8alpha-ergosterol peroxide-6,22(E)-diene-3beta-alcohol to the preparation of an anti-tumor drug. A great number of experiments show that the 5alpha-8alpha-ergosterol peroxide-6,22(E)-diene-3beta-alcohol has the remarkable effect of suppressing malignant tumors such as malignant mammary tumor cells, lymphoma cells and encephaloma cells, and particularly has the effect of killing drug-resistant tumor stem cells such as encephaloma stem cells, so that the 5alpha-8alpha-ergosterol peroxide-6,22(E)-diene-3beta-alcohol can be used for the preparation of the anti-tumor drug, and the drug contains 5alpha-8alpha-ergosterol peroxide-6,22(E)-diene-3beta-alcohol of effective content and a pharmaceutically acceptable carrier.
Owner:GUANGDONG YUEWEI EDIBLE FUNGI TECH +1

Traditional Chinese medicinal composition for treating breast cancer and preparation method thereof

The invention discloses a traditional Chinese medicinal composition for treating breast cancer. In the traditional Chinese medicinal composition, the oral medicament is prepared from white peony root, pilose asiabell root, astragalus root, angelica, rhizoma drynariae, spica prunellae, radix gentianae, lithosperm root, rhizoma atractylodis macrocephalae, gamboges, scorpion, Tuckahoe, lumbricus, Chinese sage herb, fructus psoraleae, frankincense, nutgrass galingale rhizome and rhizoma paridis; and the external medicine is prepared from arisaema tuber, red sage root, prepared kusnezoff monkshood root, dahurian patrinia herb, suberect spatholobus stem, giant typhonium rhizome, frankincense, myrrh, szechuan lovage rhizome, mongolian dandelion herb, dahurian angelica, scorpion and ginger. The traditional Chinese medicinal composition has the advantages of strong targeting property with direct access to affected parts, low cost and the like, and is convenient for administration and manufacture. The traditional Chinese medicinal composition has the beneficial effects that traditional Chinese medicinal materials with different medicine properties are scientifically combined so as to reach ideal and safe therapeutic effect; by adopting oral and external administration modes, antitumor function can be realized, mammary tumor cells are eliminated and bone metastasis is inhibited, thus improving symptoms of a patient maximally, enhancing life quality and prolonging life; and the composition has low cost and is convenient to use, thus creating higher social value and higher economic benefit.
Owner:潘国芬

Tumor eliminating powder

The invention provides a tumor eliminating powder, including: Uroctea 1-10 shares, batryticated silkworm 2-8 shares, pod 2-15 shares, vermilion 1-6 shares, Fructus Ziziphi Jujubae 5-20 shares, spider 3-12 shares, and also including: Chinese angelica 3-12 shares, Mamyflower Gueldemstaedtid Herb 3-15 shares, and Commiphora Myrrha 1-10 shares. It can be applied to cure proliferation of mammary gland, mastitis, mastadenoma, poisoned sore, thyroid tumor, lymphoma, etc, and its curative effect is good and it has no toxicity and side effect.
Owner:冷学吉 +1

Compositions and methods for the therapy and diagnosis of breast cancer

Compositions and methods for treating and diagnosing cancer, such as breast cancer, are disclosed. Compositions may include one or more breast tumor proteins, immunogenic portions thereof, or polynucleotides encoding such portions. Alternatively, the therapeutic composition may include antigen presenting cells expressing a breast tumor protein or T cells specific for cells expressing such protein. Such compositions can be used, for example, in the prevention and treatment of diseases such as breast cancer. Also provided are diagnostic methods based on the detection of breast tumor proteins or mRNA encoding such proteins in a sample.
Owner:CORIXA CORP

Mouse models to study cachexia

Embodiments of the invention provide mouse tumor models involving either the B16 mouse melanoma or MXT mouse mammary tumor, untreated or treated with chemotherapy and / or anti-cachectic agents, for the study of tumor-generated or cancer therapy-generated cachexia-inducing signals and mechanisms. Other embodiments of the invention also provide additional models, including pre-treatment of mouse skin with anti-cachectic proteins prior to tumor implantation, for the study of anti-cachectic signals and mechanisms generated by the skin. To reduce or reverse tumor- and chemotherapy-induced cachexia, embodiments of the invention use the human proteins placental alkaline phosphatase, transferrin, α1-antitrypsin preparations or combinations thereof as well as chemically synthesized CCDTHT or N,N-diethyl-N-methyl-2-[(9-oxo-9H-thioxanthen-2-yl)methoxy]-ethanaminium iodide or CCDTHT-like compounds.
Owner:ZOLTAN LAB

Reconstituted human breast tumor model

InactiveUS20060123493A1Compounds screening/testingVirusesAbnormal tissue growthHuman Mammary Epithelium
A reconstituted human breast tumor model is disclosed. The model, which is incorporated into mice, provides actual tumors that arise spontaneously, thereby mimicking naturally occurring breast cancer. The tumors are genetically human, because they arise from human mammary tissues that develop from human mammary epithelial cells implanted into host mice. Prior to implantation, the mammary epithelial cells are genetically modified to contain a recombinant human oncogene and an SV40 early region.
Owner:AVEO PHARM INC

Use of miR-100 inhibitor in cancer metastasis reduction

The invention relates to a use of an miR-100 inhibitor in cancer metastasis reduction, and concretely relates to a use of a reagent for determining the miR-100 expression level in the preparation of breast cancer diagnosis reagents, and a use of the miR-100 inhibitor, and a use of the miR-100 inhibitor or an miR-100 antagonist in the preparation of medicines for treating breast cancer. Up-regulation of miR-100 in in-vivo tumor related macrophages and in-vitro induced M2 type macrophages is induced by tumor micro-environment. In in-vivo test, the microRNA antagonist knocks down the expression of the miR-100 in mouse mammary gland tumor tissues, and a case that in-situ tumor growth has no statistic difference, the quantity of lung metastasis tubercles is obviously down-regulated and the mammary gland tumor metastasis is inhibited in an experiment group of the miR-100 down-regulation in the tumor related macrophages is found.
Owner:THE INST OF BASIC MEDICAL SCI OF CHINESE ACAD OF MEDICAL SCI

Use of Dayan peptide/inflammation factor/in preparing tag diagnosing mammary cancer

The present invention relates to application of macro inflammatory peptide / inflammatory factor 1 in preparing marker for diagnosing mammary cancer, and aims at providing mammary cancer diagnosis with determined specific marker. The macro inflammatory peptide / inflammatory factor 1 have the amino acid sequence of: SQTRDLQGGKAFRLLKAQQEERLDEINK QFLDDPKYSSDEDLPSDLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP, is white powder and water soluble, and has molecular weight of 17 KDa. The macro inflammatory peptide / inflammatory factor 1 is used as used as antigen in preparing monoclonal and polyclonal antibody through standardized process for mammary cancer diagnosis. The present invention has mammary tumor diagnosing effect not inferior to HE process and may obtain result more precise than that of HE process.
Owner:HUAZHONG UNIV OF SCI & TECH

Medicine for treating mammary gland proliferation and mammary gland tumor and its preparation method

The present invention relates to a Chinese medicine for effectively curing the diseases of hyperplasia of mammary glands and tumor of breast and its preparation method. Said Chinese medicine is made up by using 10 Chinese medicinal materials of liquidambar, wild aconite tuber, flying squirrel's droppings, earthworm, myrrh, musk and others through a certain preparation process. Said invention also provides the concrete steps of said preparation process.
Owner:沈金苏

Reconstituted human breast tumor model

Reconstituted human breast tumor models are disclosed. The models, which are incorporated into mice, provide actual tumors that arise spontaneously, thereby mimicking naturally occurring breast cancer. The tumors are genetically human, because they arise from human mammary tissues that develop from human mammary epithelial cells implanted into host mice. Prior to implantation, the mammary epithelial cells are genetically modified to contain either: (a) a recombinant human oncogene and an SV40er; or (b) a recombinant human oncogene, a transgene or shRNA that inhibits the p53 pathway, and a transgene or shRNA that inhibits the Rb pathway.
Owner:AVEO PHARM INC

Herba taraxaci essence cream and method for preparing same

The invention relates to herba taraxaci essence cream and a method for preparing the same. By the aid of the herba taraxaci essence cream and the method, the problems of long preparation time and high loss of nutritional components of existing herba taraxaci preparations can be solved. The herba taraxaci essence cream comprises, by weight, 60%-70% of radix taraxaci, 15%-25% of syringa reticulata and the balance radix astragali. The method includes firstly, selecting materials; secondly, cooking the materials; thirdly, extracting primary pulp; fourthly, concentrating the primary pulp and then filling containers with the primary pulp. The herba taraxaci essence cream and the method have the advantages that the method is simple and is low in cost, convenient to implement, short in processing time and free of loss of nutritional components and trace elements; the radix taraxaci, the syringa reticulata and the radix astragali which are purely natural plants are mixed with one another to obtain radix et caulis acanthopanacis senticosi essence cream, and the herba taraxaci essence cream is made of natural raw materials, is free of toxic and side effects and convenient to take and can be used as a daily healthcare product; effects of clearing heat, removing toxicity, easing pain, resolving lump, removing dampness, treating stranguria and relieving fatigue can be realized by the herba taraxaci essence cream; obvious effects can be realized by the herba taraxaci essence cream for symptoms of mammary tumor, sore throats, gynecological inflammation, swollen sore throats, urinary tract infection and the like.
Owner:陈春祥

Resistin polypeptide vaccine and application thereof to treatment of mammary cancer

The invention discloses a resistin polypeptide vaccine and application thereof to the treatment of a mammary cancer, and belongs to the technical field of biology. A polypeptide vaccine provided by the invention is prepared from a Resistin-protein specific polypeptide segment and an immunologic adjuvant, and becomes the Resistin polypeptide vaccine. Through multiple subcutaneous injections, the vaccine can be used for activating the lymphocyte of an organism, and generates an immune neutralizing antibody aiming at Resistin protein. The Resistin polypeptide vaccine does not influence the sugartolerance and insulin tolerance levels of the organism at all. The Resistin polypeptide vaccine can be used for obviously inhibiting the growth of an ER (Estrogen Receptor) positive mammary tumor anda triple-negative mammary tumor under a mouse model; in addition, the Resistin polypeptide vaccine can be used for obviously inhabiting the growth of the ER positive mammary tumor and the triple-negative mammary tumor of a mouse under an obesity model induced by a high fat diet, and a new way is provided for ameliorating a current treatment method of the mammary cancer by the resistin polypeptidevaccine.
Owner:ACADEMY OF MILITARY MEDICAL SCI

Traditional Chinese medicine preparation for treating mammary gland hyperplasia

Disclosed is a Chinese medicinal preparation for treating mammary gland hyperplasia and tumor, which is prepared from the following raw materials: drynaria, pangolin scales, rhizoma Gastrodiae, duchesnea, pseudo-ginseng powder, prunella spike, curcuma root, ganoderma lucidum, astragalus root, Chinese angelica root, root of herbaceous peony, dandelion, oyster, cactus, myrrh, cow-bezoar and barbat skullcap.
Owner:徐樊

External use oil agent for treating proliferation of mammary gland and its prepn. method

An exterior-applied ointment for preventing and treating mastoplasia by coating it on breast and massaging is prepared from the twig and leaf of enqlish yew, taxol, safflower, red sage root and burreed tuber. Its preparing process is also disclosed.
Owner:严海勤 +1

Traditional Chinese medicine composition for treating breast cancer

The invention discloses a traditional Chinese medicine composition for treating breast cancer. The traditional Chinese medicine composition for treating the breast cancer is prepared from the following medicinal raw materials by weight: 10-20g of cowherb seed, 3-10g of edible tulip, 5-12g of pangolin, 3-8g of selfheal, 3-8g of snake grape root, 5-15g of snakegourd fruit, 3-8g of uniflower swisscentaury root, 3-8g of Indian strawberry, 5-12g of konjak, 5-12g of dysosma versipellis, 5-15g of dandelion, 3-10g of herba andrographitis, 5-12g of ground beeltle, 3-10g of muskroot-like semiaquilegia root and 3-10g of ternate buttercup root. The traditional Chinese medicine composition for treating the breast cancer has the beneficial effects that the edible tulip, the snake grape root and the like are mainly used for clearing away heat and toxic materials; the cowherb seed, the pangolin and the like are mainly used for promoting blood circulation to remove blood stasis; the konjak, the dysosma versipellis and the like are mainly used for resolving hard lumps, and all the medicinal materials are matched to inhibit the growth and the diffusion of breast cancer cells.
Owner:刘骐达

Wuzishan Chinese medicines for cancer pains

A Chinese medicine for preventing and treating breast cancer and mastoplasia and improving immunity is prepared from 32 Chinese-medicinal materials including radish seed, Chinese angelica root, red peony root, red sage root, etc.
Owner:杨少林

Tablet for treating mastosis and its preparing method

The present invention belongs to the field of Chinese medicine technology, and is especially mastosis treating tablet and its preparation process. The mastosis treating tablet is prepared with oyster seaweed, kelp, spatholobus stem, epimedium and other Chinese medicinal materials. It is used in treating hyperplasia of mammary glands, mammary tumor, mastalgia and other mastosis. Compared with available similar medicine, the mastosis treating tablet has small dosage.
Owner:李文东

Chinese medicinal herb for treating breast neoplasms

The invention discloses a Chinese medicinal herb for treating breast neoplasms, which consists of medicaments for external use and medicaments for oral administration. In the Chinese medicinal herb, the medicaments for external use are taken as main materials while the medicaments for oral administration are taken as subsidiary materials; the medicaments for external use are prepared by grinding and mixing the following 18 Chinese medicinal herbs: 1 to 10g of brimstone, 1 to 10g of red orpiment, 1 to 10g of yellow lead, 2 to 15g of marble, 1 to 10g of galalith, 1 to 10g of rhizoma drynariae, 1 to 10g of liquoric root, 1 to 10g of peristrophe baphica, 1 to 10g of leonurus heterophyllus, 2 to 15g of Chinese fevervine herb, 2 to 15g of rhynohophylla, 1 to 10g of memorialis hirta, 2 to 15g of long-stalked kadsura root, 1 to 10g of paniculate swallowwort root, 1 to 10g of cynanchum amplexicaule, 1 to 10g of Chinese forgetmenot root, 1 to 10g of cotton rose hibiscus leaf and 1 to 10g of grain husk leaf; and the medicaments for oral administration are prepared by decocting 2 to 15g of Chinese angelica, 1 to 10g of akebia stem, 2 to 15g of astragalus, 2 to 15g of October clematis stem, 3 to 20g of root of straight ladybell, 3 to 20g of apricot-leaved adenophora root, 1 to 10g of swordlike atractylodes rhizome, 1 to 6g of ricepaperplant pith and 2 to 15g of liquoric root in water. The suppression powder for the breast neoplasms of the invention has the characteristics of short treatment period, good treatment effect, no side effect and relapse prevention, and simultaneously, patients have no pain during treatment, and the treatment cost is low.
Owner:赖建明

Application of metadherin (MTDH) gene vaccine in preparation of breast cancer cell growth inhibitor

The invention belongs to the field of biotechnologies, and relates to a gene vaccine capable of inhibiting cancer cell growth. The gene vaccine can express a cell membrane surface protein metadherin (MTDH) and thus being named as a MTDH gene vaccine. The MTDH gene vaccine is utilized for immunization in an oral way. The MTDH gene vaccine can activate an immune response of CD8+ cytotoxic T cells on breast cancer cells 4T1 expressing MTDH antigens. The MTDH gene vaccine can inhibit breast cancer cell growth and pulmonary metastasis. Through being combined with adriamycin, the MTDH gene vaccine can improve adriamycin effects of inhibiting breast cancer cell growth and pulmonary metastasis, and prolong a life of a mouse loaded with cancer. More significantly, the MTDH gene vaccine does not produce obvious damages on main organs of a human body. Therefore, the MTDH gene vaccine provides a novel approach for improvement of the existing breast cancer treatment method.
Owner:上海宜诺迪生物科技有限公司

Biomarker for breast cancer

A method for the diagnosis of breast cancer using an anti-LAT1 monoclonal antibody. Among intraductal breast neoplastic lesions, duct carcinoma in situ, which is malignant, expresses LAT1 at a significantly high level, as compared to intraductal breast papilloma, which is benign. An anti-LAT1 monoclonal antibody is useful for the discrimination between these two lesions. Further, LAT1 is expressed at a high level in most of triple negative infiltrating carcinomas, which are negative for all of ER, PgR, and HER2 that are conventional molecular targeting markers for breast cancer. Therefore, LAT1 can be used as a novel molecular targeting marker for the triple negative breast cancer.
Owner:J PHARMA

Medicine for eradicating mammary gland hyperplasia and mammary gland tumors

The invention relates to a medicine for eradicating mammary gland hyperplasia and mammary gland tumors. The medicine comprises the following traditional Chinese medicine components by weight: 100g of saffron crocus, 80g of corn cervi pantotrichum, 80g of panax notoginseng, 80g of manis pentadactyla and 80g of the seed of cowherb, wherein the components compounded in proportion are soaked in white spirit with a high alcoholic strength for 30 days, and then the white spirit is taken and applied to an affected part of a patient in a repeated kneading manner so as to immediately relieve pain. The mammary gland hyperplasia and the mammary gland tumors can be eradicated if the medicine is repeatedly used.
Owner:孙仁棉

Breast pad, breast pad assembly, and mammary tumor detection device

InactiveCN105747294ATo achieve the purpose of treating breast tumorsCause damageBrassieresDiagnostic recording/measuringMammary tumorBiomedical engineering
The invention relates to a breast pad used for installation of an electrode, a breast pad assembly comprising a breast pad, and a mammary tumor detection device comprising a breast pad assembly. The breast pad comprises a C-shaped elastic pad used for the installation of the electrode, and the axial side surface of the elastic pad is provided with a clamping protrusion and a clamping hole. After the clamping protrusion is matched with the clamping hole, the elastic pad is changed from the shape of C into the shape of a horn. The breast pad, the breast pad assembly, and the mammary tumor detection device are disposed between the breast and the bra, and therefore the good contact of the electrode with the breast can be guaranteed, and the user can wear the normal brad by using the mammary tumor detection device.
Owner:BEIJING ZHIGAN SENSOR TECH RES INST CO LTD
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Eureka Blog
Learn More
PatSnap group products