Human papillomavirus shell protein L1 short peptide and application thereof

A human papillomavirus, coat protein technology, applied in the field of human papillomavirus coat protein L1 short peptide, can solve the problems of unsuitable storage, unpredictable CINI/II natural regression, and inability to distinguish persistent infection or reinfection, etc.

Inactive Publication Date: 2008-05-28
CHINA THREE GORGES UNIV
View PDF0 Cites 22 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, it is not possible to distinguish between persistent infection and reinfection
(2) HPV mRNA detection: It can monitor the expression of oncogenes such as E6 and E7, which is related to the progression of the disease. When the disease worsens, the level of E6 and E7 mRNA increases, but the RNA stability is poor, so it is not suitable for storage
(3) HPV virus amount: HPV virus amount has been proposed as a means of identifying the risk of disease, but it is controversial, and most studies cannot set a uniform standard for the number of cells in each sample. Therefore, effective HPV virus The number of cells in the specimen should be adjusted prior to quantitative assessment
IgG1 and IgG2 against HPV16 antigen are significantly higher in cervical cancer than in CIN patients, therefore, IgG subclass analysis or direct detection of cellular immunity against viral antigens in patients with positive serological reactions can effectively predict the natural regression of CIN, but , Koji Matsumoto found that the IgG antibody of the L1 capsid protein was not associated with the regression of CIN after 2 years, thus pointing out that the IgG response of the HPV L1 capsid protein cannot predict the natural regression of untreated CIN I / II

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Human papillomavirus shell protein L1 short peptide and application thereof
  • Human papillomavirus shell protein L1 short peptide and application thereof
  • Human papillomavirus shell protein L1 short peptide and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0070] (a) Synthesis of HPV L1 short peptide

[0071] In this embodiment, based on the protein sequence of HPV16 L1 aa448-477 segment, the peptide length is 30 amino acids, and the sequence is: EVNLKEKFSADLDQFPLGRKFLLQAGLKAK.

[0072] Beijing Saibaisheng Gene Technology Co., Ltd. was entrusted to synthesize the short peptide of this sequence in Genemed Synthesis Inc. of the United States by conventional methods.

[0073] (b) Preparation of antiserum

[0074] After dissolving the synthetic short peptide in PBS, add Furend's complete adjuvant 1:1, emulsify and immunize Japanese long-eared white rabbits and Balb / c mice with doses of 25ug and 10ug, respectively, three times in total. On the 14th day of the last immunization, the animals were sacrificed, and the rabbit antiserum and mouse antiserum against the short peptide were collected.

Embodiment 2

[0076] Western Blot detection of reactivity of anti-short peptide antiserum to recombinant HPV16 L1

[0077] Sf9 cells expressing recombinant HPV16 L1 were obtained from the Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences.

[0078] Perform polyacrylamide gel electrophoresis on the lysate of sf9 cultured cells expressing recombinant HPV16 L1, transfer the gel after electrophoresis to a nitrocellulose membrane, and then use rabbit or mouse anti-short peptide antiserum as the primary antibody to conduct polyacrylamide gel electrophoresis reaction. As a result, the short peptide immune antiserum of mice and rabbits could cause a specific reaction band to appear at the position of 56KD on the electrophoresis lane of the lysate of sf9 cultured cells expressing recombinant HPV16 L1 (Fig. 1).

Embodiment 3

[0080] ELISA detection and Western Blot detection of the reactivity of anti-short peptide antiserum to cultured cells containing HPV virus

[0081] Caski cells containing HPV16 virus and Hela cells containing HPV18 virus were purchased from the China Cell Collection Center of Wuhan University. Imported HRP-labeled and fluorescent-labeled secondary antibodies were purchased from Beijing Zhongshan Biotechnology Co., Ltd. (sigma products).

[0082] The lysates of Caski cultured cells containing HPV16 virus and Hela cultured cells containing HPV18 were coated on plastic plates, and the anti-serum of rabbit or mouse anti-short peptide was used as the primary antibody to react with them. As a result, the anti-serum against short peptides of mice and rabbits could make Caski cultured cells and Hela cultured cell lysates coated plastic plates show positive reaction (Fig. 2).

[0083] Perform polyacrylamide gel electrophoresis on the lysate of Caski cultured cells containing HPV16 vir...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a polypeptide, in particular to a human papilloma virus coat protein L1 short peptide and relative application. The invention is characterized in that the sequence of the human papilloma virus coat protein L1 short peptide is N-EVNLKEKFSADLDQFPLGRKFLLQAGLKAK-C. The invention can simultaneously induce human papilloma virus coat protein L1 short peptide with immunity reaction on high risk type and low risk type, which can induce and form the antibody for various human papilloma virus (HPV) and coat protein (HPV L1), to check various HPV or HPV L1, while the antibody can be used in biological pharmaceutical engineering, to purify and prepare various HPV or HPV L1.

Description

Technical field: [0001] The invention relates to a polypeptide, in particular to a human papillomavirus coat protein L1 short peptide and application thereof. technical background: [0002] Human papillomavirus (HPV) was first discovered in 1933, and the first genital HPV was identified in 1978. At present, according to the different gene expression of human papillomavirus (HPV) DNA sequence, more than 200 subtypes of human papillomavirus (HPV) have been identified, of which 85 kinds of HPV gene clones have been identified, and some genes of another 120 kinds Types were identified, and more than 30 species were isolated from reproductive tract tissues. According to the site of human papillomavirus (HPV) infection, it is divided into skin type and mucosal type; according to its pathogenicity, it is divided into high-risk type and low-risk type. The high-risk types mainly include HPV16, 18, 33, 31, 58, and 52, which are related to the incidence of cervical cancer, and the lo...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/025C07K16/06C07K16/28G01N33/531G01N33/577G01N33/543
Inventor肖长义万涛黄利鸣
OwnerCHINA THREE GORGES UNIV