Single chain FC polypeptides

A single-chain and polypeptide-chain technology, applied in the field of single-chain Fc polypeptides, can solve problems such as low-yield chromatographic procedures and complicated preparation processes

Inactive Publication Date: 2009-07-29
UCB SA
View PDF33 Cites 11 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Despite the availability of desirable functional molecules, the preparation is complex and includes low-yielding chromatographic procedures

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Single chain FC polypeptides
  • Single chain FC polypeptides
  • Single chain FC polypeptides

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0162] Three murine single-chain Fc polypeptides were designed containing a biologically active molecule at their N-terminus, wherein the biologically active molecule is an antibody Fab fragment. The variable regions of the Fab fragments are derived from the murine antibody Mox46, which binds cell surface protein antigens. The Fc domains are derived from murine IgG2a and three different versions of these domains are shown below. Linker sequences are underlined. Hinge sequences are italicized and sequences forming part of the linker are italicized and underlined.

[0163] version 1 SEQ ID NO: 88 (as in figure 2 in the form shown in b). Cysteine ​​in the hinge between CH1 and CH2 has been replaced by serine.

[0164] EPRGPTIKPSPPSKSPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSED

[0165] DPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFK

[0166] CKVNNKDLPAPIERTISKPK GGGGSGGGGSGGGGSGGGGSGGGGS APNLLG

[0167] GPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQT

[0168] ...

Embodiment 2

[0198] Example 2: Antigen Binding

[0199] The ability of single-chain Fc polypeptides (versions 1 and 3) to bind antigen was compared to that of the same antibody variable region (from the MOX46 antibody) expressed in the murine IgG1 framework and an irrelevant IgG. Recombinant NSO cells (5×10 5 ) and 100 μl of single-chain Fc polypeptide were incubated at 4° C. for 30 minutes. The control was MOPC21, titrated with a 1 / 3 dilution of said MOPC21 at 5 μg / ml. Titrations were performed with 1 / 3 dilutions of MOX46 IgG and single chain Fc polypeptide constructs. Wash the cells twice with Dulbecco's PBS containing 5% FCS and 0.1% sodium azide, then add 100 μl of PE-labeled (Jackson) antibodies against mouse heavy and light chains diluted at 1 / 250, at 4°C Incubate for 30 minutes. Cells were washed once more before analysis by flow cytometry.

[0200] Like MOX46 IgG, both single chain Fc polypeptide constructs tested bound antigen (1.1 and 3.1). Irrelevant controls did not bind ...

Embodiment 3

[0203] Example 3: Fc receptor binding

[0204] The ability of single chain Fc versions 1 and 3 to bind the Fc receptors CD64 (FcyRII) and CD32 (FcyRI) was determined by BIAcore. CD64 and CD32 were immobilized (approximately 1000 RU each) on flow cells 2 and 3 of a standard CM5 Biacore chip, respectively, using amino-coupling chemistry. Set flow cell 1 as the reference flow cell to check for background binding. The single chain Fc protein was then injected into the sequence covering the chip to check the binding activity. All samples were run undiluted and diluted 1:2 and 1:5. All samples showed no significant background binding.

[0205] Both versions 1 and 3 of the single chain Fc were found to bind both CD64 and CD32.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention relates to single chain polypeptides comprising one or more immunoglobulin Fc domains. In particular the present invention relates to single-chain Fc polypeptides in which at least one functional Fc domain is formed within the polypeptide chain.

Description

technical field [0001] The present invention relates to single chain polypeptides comprising one or more immunoglobulin Fc domains. The invention specifically relates to single chain Fc polypeptides forming at least one functional Fc domain within said polypeptide chain. Background technique [0002] Immunoglobulins are bivalent, Y-shaped molecules comprising two identical heavy chains and two identical light chains. Disulfide bonds connect heavy and light chain pairs and two heavy chains. Each chain includes a variable domain that varies in sequence and is responsible for antigen binding, the variable domains in the heavy and light chains are referred to as V H and V L domain. Each chain also includes at least one constant domain. The light chain has a constant domain (C L ), and at least 3 in the heavy chain (C H 1. C H 2 and C H 3), sometimes four (C H 4) (depending on isotype) constant domain. Humans have five different classes, or isotypes, of antibodies, inc...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K16/00
CPCC07K2316/52C07K2317/52C07K2317/734C07K16/00A61P1/02A61P1/04A61P1/16A61P1/18A61P3/10A61P7/02A61P9/10A61P9/14A61P11/06A61P17/06A61P19/02A61P19/10A61P25/00A61P25/28A61P29/00A61P31/00A61P31/04A61P31/10A61P31/12A61P33/00A61P35/00A61P35/02A61P37/02A61P37/06
InventorA·D·G·劳森P·E·史蒂芬斯
OwnerUCB SA