PtPLC (protein tyrosine phosphatase-like (proline instead of catalytic arginine), member c) gene of Pacifastin type serine protease inhibitor of portunus trituberculatus and a coding protein and application thereof
A technology of serine protease and Portunus trituberculatus, which is applied in the field of molecular biology, can solve the problems of no reports of Portunus trituberculatus Pacifastin-type serine protease inhibitors and the loss of Portunus trituberculatus aquaculture
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0025] The PtPLC gene of Portunus trituberculatus Pacifastin-type serine protease inhibitor is the base sequence shown in SEQ ID No.1.
[0026] The sequence listing SEQ ID No.1 is:
[0027] ggacttgcgg gcctgattct ccagagggtc gac atg aag gct caa gtg
[0028] gtg ctg ctc ctg ctg ggg gct gct gtg acg gcg gca acc agt
[0029] ccg cct ttt gtg gaa ctc cct agt gat cct gat gct cct gag
[0030] tgt gag gga cgc cca ctg gtt gac cgc tgg agg aag gac tgc
[0031] aac tgg tgc tcc tgc aat gag ggg aga gtg agg tgc tcc cga
[0032] caa ctg tgt cct gaa ggt cag cag gat cca gaa cca cag tgt
[0033] gag ggc agc ccc act tgg aag gat gac tgc aac acg tgc cgc
[0034] tgt gct ggt ggc cga gct gtg tgc acc gcc aag cac tgt gat
[0035] caa ctt ggt cca gag cag cag att gtg gaa gtg cag gtg gag
[0036] agt gca gag tgt aag gaa ggc tcc cgg tgg cgt gtg gag tgc
[0037] aat tgg tgc acc tgt cgg gga ggg aag ggc gcc tgc aca gag
[0038] atg gcc tgt tta aac tgg gat gag gac cag gca cgg gag gat
[0039] gga atc ...
Embodiment 2
[0096] The base sequence of Portunus trituberculatus Pacifastin-type serine protease inhibitor PtPLC is described in SEQ ID No.1 in the sequence listing, and the amino acid sequence is described in SEQ ID No.2 in the sequence listing.
[0097] The sequence listing SEQ ID No.2 is:
[0098] MKAQVVLLLLGAAVTAATSPPFVELPSDPDAPECEGRPVDRWRKDCNWCSCNEGRVRCSRQLCPEGQQDP
[0099] EPQCEGSPTWKDDCNTCRCAGGRAVCTAKHCDQLGPEQQIVEVQVESAECKEGSRWRVECNWCTCRGGKGA
[0100] CTEMACLNWDEDQAREDGILECHGSSRWKKDCNWCRCAEGRGFCTKKACPQTGPFDNLPEDMCVPGSRWL
[0101] VDCNWCGCSDDGRSSFCTLMACIPGYVHEGPTCEDGSVWKTDDCNICRCIDGMSACTKRLCATPNQEPRTP
[0102] QVPNEPECQGELGIDRWRQDCNWCNCRNGAGACTKRQCLEGVKDDQPECEGNPSWMKDCNRCHCVDGRVC
[0103] TTKFCGEFRK
[0104] It has a complete coded protein containing 365 amino acids, of which 1-17 amino acids of the coding sequence are signal peptides, and the mature peptide contains 348 amino acids, with a predicted molecular weight of 38.86 kDa and an isoelectric point of 4.99. The mature pep...
Embodiment 3
[0108] Inhibitory activity test of PtPLC recombinant protein of Portunus trituberculatus Pacifastin type serine protease inhibitor:
[0109] 1. Preparation of protease solution and reagents: Bovine trypsin and bovine α-chymotrypsin were respectively dissolved in 1M Tris-HCl solution (pH=7.0) to make the protease concentration reach 0.1mg / ml, and set aside at 4°C. 4-(2-Aminoethyl)benzenesulfonyl fluoride hydrochloride (AEBSF) was dissolved in 1M Tris-HCl solution (pH=7.0) to make the concentration of AEBSF reach 100mM, set aside at 4°C. A 1% Azocasein substrate solution with a mass fraction of 1% was prepared with a phosphate buffer solution with a pH value of 7.2. The operation was carried out under sterile conditions, and it was stable in a refrigerator at 4° C. for 2-3 days before use. Take 10g of trichloroacetic acid (TCA) and dissolve it in 50ml of double-distilled water, and finally dilute to 100ml to prepare 10% TCA, and store it at 4°C for later use.
[0110] 2. Determ...
PUM
| Property | Measurement | Unit |
|---|---|---|
| molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 