A preparing method of bispecific antibodies targeting a mouse T lymphocyte CD3 and a human tumor antigen EpCAM, and applications of the bispecific antibodies
A bispecific antibody, target cell technology, applied in the direction of anti-receptor/cell surface antigen/cell surface determinant immunoglobulin, antibody, antitumor drug, etc. Therapeutic, efficacy-enhancing effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0060] Example 1: Preparation of bispecific antibody (EpCAM×mCD3, M706)
[0061] 1. Bispecific antibody sequence design
[0062] The bispecific antibody targeting EpCAM and mCD3 was named M706, such as image 3 , the anti-EpCAM here is in the form of IgG, including anti-EpCAM heavy chain and light chain, and the anti-mCD3 is in the form of ScFv-Fc, including anti-mCD3 VH, VL, and Fc domains.
[0063] Anti-EpCAM heavy chain (amino acid sequence SEQ ID NO.1)
[0064] EVQLLEQSGAELVRPGTSVKISCKASGYAFTNYWLGWVKQRPGHGLEWIGDIFPGSGNIHYNEKFKGKATLTADKSSSTAYMQLSSLTFEDSAVYFCARLRNWDEPMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0065] Anti-EpCAM light chain (amino acid sequence SEQ ID NO.2) ...
Embodiment 2
[0084] Example 2: Preparation of mouse tumor cell lines expressing human tumor antigen EpCAM
[0085] 1. Murine Tumor Cell Preparation
[0086] B16 mouse melanoma cells and CT26.WT mouse colon cancer cells were purchased from the Cell Bank of the Cell Resource Center, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences.
[0087] 2. Acquisition of antigen gene and construction of expression vector
[0088] The cultured HCT116 cells expressing human EpCAM were collected, centrifuged at 400 g for 5 min, and the supernatant was discarded. Add the same volume of PBS as the culture medium before centrifugation, resuspend the pellet, centrifuge at 400g for 2-3 minutes, and discard the supernatant. Using Invitrogen's The reagent kit (15596-026) was operated according to the instructions to extract the total RNA of the cells.
[0089] Firstly, random primers in the 5'RACE FULL kit (purchased from TAKARA, product number D315) of Takara Company were used to re...
Embodiment 3
[0101] Example 3: In Vitro Cell Killing Detection
[0102] 1 Mouse splenocyte preparation:
[0103] Bluntly separate the mouse spleen, inject PBS into the spleen repeatedly with a syringe, collect the outflowing spleen cell suspension, centrifuge at 400g for 10min, resuspend the pellet in PBS, act with 5 times the volume of red blood cell lysate (beyotime, C3702) for 5min, and then centrifuge at 400g 5min, after washing once with PBS, resuspend the cells in 10% FBS-1640 medium to 1×10 6 cells / ml, spare.
[0104] 2 Preparation of mouse tumor cells expressing human tumor antigens
[0105] B16-EpCAM / CT26-EpCAM cells were cultured in RPMI-1640 (GIBCO, C11875) + 10% FBS (BI, 04-001-1A). After culture, the cells were digested with 0.25% trypsin for 20 seconds, collected and centrifuged. Supernatant, resuspended to 1% FBS-PBS to make a single cell suspension, Vi-Cell cell counter to detect cell number and viability, stained with CFSE at a final concentration of 5uM, 5% CO 2 , i...
PUM
Property | Measurement | Unit |
---|---|---|
Affinity | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com