A kind of method for synthesizing pramlintide

A technology of pramlintide and linear peptides, which is applied in the chemical industry, can solve problems such as product yield reduction, production troubles, and purification separation column damage, and achieve the effects of low cost, high synthesis efficiency, and wide application prospects

Active Publication Date: 2022-04-08
HANGZHOU GOTOP BIOTECH
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, in actual production, the oxidation process of pramlintide has brought great trouble to the production. After the oxidation of pramlintide is completed, it is easy to form an emulsion-like state under weakly alkaline conditions, and this state It will have a great impact on the purification and separation in the later stage. If the sample is loaded directly without filtration, it will not only damage the purification separation column, but also reduce the product yield.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of method for synthesizing pramlintide
  • A kind of method for synthesizing pramlintide

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0025] A method for synthesizing pramlintide, comprising the steps of:

[0026] Step 1: Carry out fragment coupling reaction on the Rink Amide MBHA resin with a substitution degree of 0.25-0.40mmol / g; wherein, considering the synthetic pramlintide fragment 1 in step 2, which has a length of 31 amino acids, the selected Rink AmideMBHA resin replaces It is advisable that the concentration range is 0.25-0.40mmol / g.

[0027] Step 2: Synthesis of pramlintide fragment 1: Fmoc-Tyr(tBu)-OH is sequentially coupled from the C-terminus to the N-terminus until Fmoc-Cys(Trt)-OH at the 7th position of the N-terminus, and the Fmoc protecting group is removed; wherein, The amino acids used in the synthesis are all amino acids protected by Fmoc at the N-terminal, the Cys side chain is protected by Trt, the Asn side chain is protected by Trt, the Thr side chain is protected by tBu, the Gln side chain is protected by Trt, the Arg side chain is protected by Pbf, and the His side chain is protecte...

Embodiment 2

[0053] Step 1: Perform fragment coupling reaction on Rink Amide MBHA resin with a substitution degree of 0.25-0.40 mmol / g.

[0054]Step 2: Synthesis of pramlintide fragment 1: Fmoc-Tyr(tBu)-OH is sequentially coupled from the C-terminus to the N-terminus until Fmoc-Cys(Trt)-OH at the 7th position of the N-terminus, and the Fmoc protecting group is removed; wherein, The amino acids used in the synthesis are all amino acids protected by Fmoc at the N-terminal, the Cys side chain is protected by Trt, the Asn side chain is protected by Trt, the Thr side chain is protected by tBu, the Gln side chain is protected by Trt, the Arg side chain is protected by Pbf, and the His side chain is protected by Pbf. The side chain is protected by Trt, the Ser side chain is protected by tBu, and the Tyr side chain is protected by tBu; among them, the N-terminal 28 and 29 use the dipeptide amino acid Fmoc-Pro-Pro-OH, and the N-terminal 24 and 25 use the dipeptide amino acid Fmoc -Gly-Pro-OH, N-ter...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a method for synthesizing pramlintide, comprising synthesizing pramlintide fragments 1 and 2, making a hydrazide 2cl resin with a substitution degree of 0.5-0.8mmol / g, and cracking pramlintide fragment 1 and pramlintide fragments respectively 2. Synthesis of crystalline pramlintide linear peptide and oxidized crystalline pramlintide linear peptide; the present invention adopts Fmoc solid-phase method and hydrazide method to synthesize long peptides, carries out fragment coupling reaction through dipeptide fragments, and uses DMSO oxidation at the same time, It has the characteristics of high synthesis efficiency, high yield and low cost, is suitable for large-scale production, has considerable economic and practical value, and has broad application prospects in the field of peptide drug design and synthesis.

Description

technical field [0001] The invention relates to the technical field of chemical engineering, in particular to a method for synthesizing pramlintide, in particular to a solid-phase synthesis method for a hypoglycemic polypeptide drug pramlintide. Background technique [0002] Pramlintide is a polypeptide drug for treating diabetes, which has good effect and few side effects, and has a good market prospect. [0003] The Chinese preparation name of Pramlintide is Pramlintide Acetate, the polypeptide sequence is: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S), the English name is: Pramlintide, molecular formula: C171H267N51O53S2, molecular weight: 3949.47, CAS accession number: 196078-30-5. [0004] In the synthesis process of pramlintide, there are many introductions of disulfide bond ring formation, and there are also many reports on the oxidation of pramlintide. However, in actual production, the oxidation process of pramlintide has brought great trouble to the production. ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityPatents(China)
IPC IPC(8): C07K14/575C07K1/06C07K1/16A61P3/10
CPCC07K14/575A61P3/10Y02P20/55
Inventor肖攀沈永刚谢振亮程益明沈永良郑远鹏沈银超
OwnerHANGZHOU GOTOP BIOTECH