Novel immunologic adjuvant, compound and application thereof

An immune adjuvant and compound technology, applied in the field of compounds and new immune adjuvants, can solve the problems of lack of immune cell activation enhancement, vegetable oil adjuvant and Freund's adjuvant local stimulation, etc., to enhance the induction ability and enhance the binding ability , Enhance the effect of TLR7 activation

Pending Publication Date: 2021-08-10
王竹林
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] The technical problem to be solved by the present invention is to provide a new type of immune adjuvant, in view of the above-mentioned inorganic aluminum series adjuvants lacking the activation enhancement effect on immune cells, vegetable oil adjuvant and Freund's adjuvant have local irritation and other adverse reactions. Compounds and their applications

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Novel immunologic adjuvant, compound and application thereof
  • Novel immunologic adjuvant, compound and application thereof
  • Novel immunologic adjuvant, compound and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0052]Embodiment 1 AlumT-I preparation:

[0053] Add 10 mg (14 μmol) of T-I to 2.5 mL of purified deionized water, and add 14 μL solution containing 0.56 mg NaOH to form a clear solution. Then add 2 mL of Alhydrogel (Invivogen, containing 9.0-11.0 mg / mL of aluminum), 1 mL of histidine buffer solution (100 mM, pH 6.5), and finally add 4.5 mL of deionized water. The resulting mixture was stirred slowly at room temperature for 1 hour to obtain AlumT-I adjuvant (about 10 mL). Store at room temperature 20-25°C. The mass ratio of T-I to aluminum is 1:2, and the molar ratio is 1:53.

[0054] The preparation of AlumT-II, AlumT-III, and AlumT-IV is the same as that of AlumT-I.

Embodiment 2

[0055] Example 2 Preparation of 54-peptide vaccine (Vac) with peptide 54-peptide in FZD7 protein as antigen

[0056] Frizzled7 (FZD7) is an antigen marker of tumor stem cells ["Frizzled7 as an emerging target for cancer therapy". -7as a potential therapeutic target incolorectal cancer".Neoplasia.2008Jul; 10(7):697-705], the main peptide 54 was selected as an antigen to prepare a therapeutic vaccine;

[0057] Add 10 mg of APVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEIC (54 peptide) to 10 mL of AlumT-I adjuvant, and shake gently at room temperature to obtain the 54 peptide vaccine (Vac1).

Embodiment 354

[0058] Example 3 Using 54 peptide vaccine (Vac1 vaccine, i.e. 54 peptide+AlumT-I) as the immune anti-tumor experiment of therapeutic vaccine

[0059] BALB / c mice aged 4-6 weeks, which are homologous to CT26.WT cells, were selected and subcutaneously injected with 2.0×10 5 CT26.WT cells, when the tumor diameter reached 4-5 mm, the tumor-bearing mice were randomly divided into PBS group, Alum group (Alhydrogel), Alum+54 peptide, T-I+54 peptide, Vac1 group (vaccine group, AlumT-I+54 peptide) group, 10 rats in each group. Start group injection and vaccine injection, Alum group contains Al (1mg / Alhydrogel 100μL), Alum+54 peptide group (containing Al 1mg / Alhydrogel 100μL plus 54 peptide 100μg), T-I+54 peptide group (containing T-I 100μg plus 54 peptide 100 μg plus PBS 100 μL), Vac1 group (vaccine group, AlumT-I 100 μL plus 54 peptide 100 μg). The injection volume of each group was 100 μL, and the vaccine was injected on the 8th day, the 12th day, the 15th day, the 19th day and the...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention provides a novel immunologic adjuvant, a compound and application thereof. The immunologic adjuvant is composed of a general formula I, a general formula II or a general formula III. According to the immunologic adjuvant disclosed by the invention, a small molecule TLR7 agonist with an immunological enhancement effect and aluminum hydroxide form a tight coordination body, and an immune cell activation effect can be superimposed on the basis of keeping the characteristics of an aluminum adjuvant.

Description

technical field [0001] The present invention relates to the field of immunization and vaccine adjuvant, more specifically, relates to a novel immune adjuvant, compound and application thereof. Background technique [0002] Traditional vaccine adjuvants include inorganic aluminum series adjuvants, vegetable oil series adjuvants, Freund's incomplete adjuvants and complete Freund's adjuvants, among which inorganic aluminum series adjuvants include aluminum hydroxide, aluminum sulfate, aluminum sulfate dodecahydrate Potassium (alum), aluminum phosphate, etc.; vegetable oil series adjuvants include peanut oil emulsification adjuvant, mineral oil, vegetable oil, etc. [0003] The above-mentioned vegetable oil adjuvant and Freund's adjuvant all have adverse reactions such as local irritation. One of the important roles of traditional aluminum adjuvants in vaccines is to physically adsorb antigens, localize and stabilize vaccine components to fully attract immune presenting cells f...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): A61K39/39A61P37/04A61P35/00C07F9/6561
CPCA61K39/39A61P37/04A61P35/00C07F9/65616A61K2039/55505A61K2039/55511
Inventor 王竹林靳广毅
Owner 王竹林
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap