HER2 targeting affinitybody and application thereof
A RESCA-HER2-BCH, targeted technology, applied in the field of radiochemistry, clinical nuclear medicine, and organic chemistry, can solve the problems of high blood pool and liver background, long half-life, slow blood pharmacokinetics, etc. Effects of renal toxicity, rapid renal metabolism, and good in vivo stability
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0038] 68 The preparation method of Ga-RESCA-HER2-BCH includes: taking 1 mL of 0.05 M HCl solution for washing 68 Add Ga to 65 μl 1M NaAc; add 10 μl 10 mg / ml RESCA-HER2-BCH precursor to the above system, mix well, 90±5 o C reaction for 10-15 min, when the labeling rate is less than 90%, use Sep-pak C18 Column to separate and purify, wherein the Sep-pak column needs to be activated with 5 mL of absolute ethanol and 5 mL of high-purity water for backup, and 3.0-5.0 mL of normal saline Elute radioactive impurities, and then elute the target compound with 0.6±0.1 mL 80% ethanol 68 Ga-RESCA-HER2-BCH, using radio-HPLC or radio-TLC to determine the labeling rate and radiochemical purity.
[0039] Made 68 The radiochemical purity of Ga-RESCA-HER2-BCH after isolation and purification is greater than 99%.
[0040] 18 The preparation method of F-RESCA-HER2-BCH comprises: the accelerator production containing 18 f - H 2 18 O through the QMA ion exchange column, the 18 f - Adsor...
Embodiment 1
[0048] Example 1 Preparation of Affibody RESCA-HER2-BCH Targeting HER2
[0049] Preparation of RESCA-(AEEA)-VDNKFNKEMRNAYWEIALPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK[(Acp)-(Acp)] was obtained by solid phase synthesis.
[0050] 1. resin swelling
[0051] Put 2-Chlorotrityl Chloride Resin into the reaction tube, add DCM (15ml / g), and shake for 30min.
[0052] 2. first amino acid
[0053] Filter the solvent through the sand core, add 3 times molar excess of Fmoc-L-Lys(Dde)-OH, add DMF to dissolve, then add 10 times molar excess of DIEA (N,N-diisopropylethylamine), Shake for 60min. Block with methanol.
[0054] 3. Deprotection
[0055] Remove DMF, add 20% piperidine DMF solution (15ml / g), shake for 5min, remove and add 20% piperidine DMF solution (15ml / g), shake for 15min.
[0056] 4. detection
[0057] Take out the piperidine solution, take more than a dozen resins, wash them three times with ethanol, add detection reagents for detection, heat at 105°C-110°C for 5min, ...
Embodiment 268G
[0084] Example 2 68 Preparation of Ga-RESCA-HER2-BCH
[0085] The RESCA-HER2-BCH prepared in Example 1 is subjected to nuclide 68 Ga(T 1 / 2 =68 min; β + :89%; E=511keV) marks, 68 For Ga 68 Ge- 68 Ga generators are prepared. Take 1 mL of 0.05 M HCl solution to rinse 68 Add Ga to 65 μl 1M NaAc; add 10 μl 10 mg / ml RESCA-HER2-BCH precursor (water-soluble) to the above system, mix well, 90±5 o C was reacted for 10-15 min. When the labeling rate was less than 90%, it was separated and purified with Sep-pak C18 Column to obtain 68 Ga-RESCA-HER2-BCH. preferred 68The radiochemical purity of Ga-RESCA-HER2-BCH is greater than 99%. Take an appropriate amount of sterile-filtered product preparations for quality control inspection, and carry out follow-up research after all items are qualified.
PUM
| Property | Measurement | Unit |
|---|---|---|
| Diameter | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 


