Human Ly6d recombinant protein cell secretory expression method and application
A technology for recombinant protein and cell secretion, which is applied in the direction of animal/human protein, receptor/cell surface antigen/cell surface determinant, recombinant DNA technology, etc. It can solve the problems of LY6D protein secretion and expression, which are rarely studied, protein insoluble, expression non-secretion issues
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0032] Embodiment 1 plasmid construction
[0033] 1. Gene Ly6D related sequence
[0034] (1) Sequence information: SEQ ID NO.1
[0035] ATGAGGACAGCATTGCTGCTCCTTGCAGCCCTGGCTGTGGCTACAGGGCCAGCCCTTACCCTGCGCTGCCACGTGTGCACCAGCTCCAGCAACTGCAAGCATTCTGTGGTCTGCCCGGCCAGCTCTCGCTTCTGCAAGACCACGAACACAGTGGAGCCTCTGAGGGGGAATCTGGTGAAGAAGGACTGTGCGGAGTCGTGCACACCCAGCTACACCCTGCAAGGCCAGGTCAGCAGCGGCACCAGCTCCACCCAGTGCTGCCAGGAGGACCTGTGCAATGAGAAGCTGCACAACGCTGCACCCACCCGCACCGCCCTCGCCCACAGTGCCCTCAGCCTGGGGCTGGCCCTGAGCCTCCTGGCCGTCATCTTAGCCCCCAGCCTGTGA
[0036] (2) Amino acid sequence: SEQ ID NO.2
[0037] MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALLSLLAVILAPSL
[0038] 2. Gene cloning and construction
[0039] The full-length protein 1-20 is a signal peptide, and 21-98aa is a final stable form, which is constructed into a mammalian expression vector and expressed in a 293 mammalian cell eukaryotic system. The following expression pla...
Embodiment 2
[0083] Example 2 protein expression
[0084] Eukaryotic HEK293F cells are divided into transient transfection and stable transfection. The transient transfection plasmid DNA is not integrated into the chromosome after entering the cell, and the exogenous gene is expressed in a free state. The transient transfection cycle is short, and the target protein can be obtained quickly, which can be applied to the exploration of the research and development stage and large-scale high-throughput screening of proteins. EXPI293F (human kidney embryonic epithelial cells), as a high-density expression system for mammalian cells, is widely used in the research, development and large-scale production of biological products such as recombinant DNA proteins.
[0085] 1. Transient transfection
[0087] serial number gene name signal peptide area Label Plasmid concentration (ng / ul) Plasmid 1 Ly6d A 21-98aa C-6His 1230 Plasmid 2 ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


