Three-target composition capable of regulating and controlling CAR immune cells and application thereof
A technology of immune cells and compositions, applied in the field of immunity, can solve the problems of low density, poor efficacy of CAR-T cells, and difficulty in ensuring the safety of CAR-T treatment.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0065] Further, the preparation method of the three-target CAR immune cells targeting vascular endothelial cells VEGFR1 / 2 and tumor antigens includes: cloning the sequence encoding its chimeric antigen receptor into a lentivirus or retrovirus vector, preparing reverse record virus. After infecting human T cells with the virus, three targets targeting vascular endothelial cells VEGFR1 / 2 and tumor antigens can be prepared to recognize CAR immune cells.
[0066] Optionally, the preparation method of human T cells includes the following steps: collecting peripheral blood mononuclear cells; sorting T cells from peripheral blood lymphocytes; activating and culturing the T cells.
[0067] In a third aspect, an embodiment of the present application also provides a three-target recognition regulatory molecule targeting vascular endothelial cells VEGFR1 / 2 and tumor antigens. Specifically, the three-target recognition regulatory molecules targeting vascular endothelial cells VEGFR1 / 2 an...
Embodiment 1
[0076] Example 1: Construction of CAR molecules
[0077] Based on the lentiviral vector pELPS, a CAR that can recognize vascular endothelial cell receptor VEGFR1 / 2 and tumor antigen Her2 was constructed as an example, VEGF121 and 4D5 scFv were oriented in different molecules, and G4S short peptide was used for tandem, and introduced into the second generation In the structure of CAR, the conventional second-generation CAR structure includes CD8 signal peptide, targeting molecule (4D5 scFv and / or VEGF121), CD8 hinge region, CD8 transmembrane region, 4-1BB costimulatory domain and CD3ζ domain. After the constructed sequence was digested with BamHI+SalI double enzyme, it was cloned into the pELPS vector. The schematic diagram of the CAR structure of the present embodiment is as follows. figure 1 shown.
[0078] A representative CAR structure is as follows:
[0079] Amino acid sequence of CAR-121-4D5-BBZ:
[0080] MALPVTALLLPLALLLHAARPAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEI...
Embodiment 2
[0083] Example 2: Construction of regulatory molecules
[0084] We designed a three-target regulatory molecule for the design of controllable CAR-T cells, in which each component of the three-target regulatory molecule encodes the sequence molecular structure and schematic diagram as shown in figure 2 As indicated, a biofusion expression strategy was employed. The target genes of 4D5 / Myc / 121, 4D5 / 121 / Myc and Myc / 4D5 / 121 were introduced into the N-terminal His tag, the thrombin cleavage site and the homology arms on both sides of MscI and XhoI by PCR. After double digestion with XhoI, it was cloned into pET32a(+) vector using homologous recombinase, transformed into DH5α competent cells and plated, and single clones were picked for sequencing and identification.
[0085] Amino acid sequence of 4D5 / Myc / 121 (SEQ ID NO: 1):
[0086] GSGAMDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSL...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


