Precursors of silk-like materials, silk-like materials and processes for producing both

A precursor and spinning technology, applied in the direction of botany equipment and methods, biochemical equipment and methods, chemical instruments and methods, etc., can solve the problem of not being able to clearly explain the mechanism of generating silk threads, not knowing the correct mechanism of silk threads, and being unable to Synthetic threads etc.

Inactive Publication Date: 2003-05-21
JAPAN OF RESPRESENTED BY PRESIDENT OF TOKYO UNIVERTY OF AGRI & TECH
View PDF0 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

This means that the two models cannot explain exactly how silkworms generate silk threads from liquid silk
[0006] As mentioned above, in the past, since the correct Silk I-type structure was not clarified, and the correct mechanism by which silkworms produce silk from liquid silk was not clarified, it was impossible to synthesize silk

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Precursors of silk-like materials, silk-like materials and processes for producing both
  • Precursors of silk-like materials, silk-like materials and processes for producing both

Examples

Experimental program
Comparison scheme
Effect test

preparation example Construction

[0018] The preparation method of the silk-like material precursor of the present invention is described in detail below. During the preparation of the precursor of the present invention, the kind and amount of other amino acids used together with glycine are first determined. Only one kind is preferably used, but a plurality of kinds may be used. In addition, the amount of Y used is determined according to the desired degree of water solubility. The amount of Y used is preferably less than or equal to 20% (mol) of all amino acids. When the amount of Y is too large, the stability of the obtained precursor becomes poor, thereby making fibrillation difficult. In addition, it is necessary to introduce Y in the main chain. Moreover, by A 1 represents each third A of the alanine sequence 1 The hardness of the copolymer can be adjusted by introducing serine into it.

[0019] The precursor of the present invention can be synthesized by a solid-phase peptide synthesis method, or ...

Embodiment Embodiment 1

[0033] A comparative examination of the structure and structural changes of tyrosine residues in silk was performed. By giving silkworm larvae 50mg 13 C-labeled L-tyrosine and the silk L-tyrosine residues of Bombyx mori silk 13 C isotope labeling, followed by solid high resolution 13 C NMR determination. The results demonstrated that in liquid silk and films dried from it, L-tyrosine residues adopt a random coil structure, but in silk fibers obtained from silkworm cocoons, they adopt a Silk type II structure. Next, oriented solid-state NMR measurements were performed on fibers obtained by dissolving and spinning the above-mentioned membranes in hexafluoroisopropanol (HFIP) and on silk threads obtained from silkworm cocoons, and in all cases, it was confirmed that the L-tyrosine residue adopts Silk II type structure, oriented in each molecular chain at the same time. In addition, it was confirmed by solid-state NMR that alanine and glycine residues, the main components of s...

Embodiment 2

[0034] The following compounds I, II, III and IV, which are representative chain portions of the repeat region of Bombyx mori silk, were synthesized using a solid-phase peptide synthesizer, and their water solubility was also determined. The results confirmed that I was completely insoluble in water and II, III and IV were very soluble. Through these experiments, it was confirmed that tyrosine residues are essential for the water solubility of silk. Synthesized compound: G(AG) 2 SG(AG) 2 IG(AG) 2 YG(AG) 2 IIGAGVGYG (AG) 2 IIITGFDSESSWAYEYGSYGGNAVYPGFGSSGT IV Among them, G is glycine, A is alanine, Y is tyrosine, V is valine, T is threonine, F is phenylalanine, D is aspartic acid, E is glutamic acid Acid, W is tryptophan, N is asparagine, P is proline, all of these amino acids are L-form except glycine. Example 3:

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The present invention provides precursors of silk-like materials, a process for producing the precursors, and silk-like materials made by using the same. Copolymers of the general formula: <(GA<1>)-((GA<2>)-G-Y-(GA<3>)<1>)>, the (GA<1>) moieties of which have repeated beta -turn type-II structure and which bear intramolecular hydrogen bonds formed along their respective molecular axes consecutively and serve as precursors of silk-like materials. In the formula, G is glycine; A<1> is alanine with the proviso that every third A<1> may be serine; A<2> and A<3> are each alanine, a part of which may be replaced by valine; Y is an amino acid having an asymmetric carbon atom and being capable of imparting water solubility to the copolymers; j is 6 or above; k and l are each 0 to 5; m is 1 to 7; and n is 10 or above.

Description

technical field [0001] The present invention relates to silk-like material precursors, silk-like materials produced from the precursors, and methods for their preparation. Background technique [0002] The silkworm (Bombyx mori) produces high-strength and high-elastic silk threads from liquid silk before fibrillation in a very short time at room temperature. As we all know, this silk thread has a high reputation as a high-grade fabric. In addition, since the silk thread can be decomposed by microorganisms, it does not cause environmental pollution. Although the primary structure of silk and the secondary structure of silk (hereinafter referred to as Silk II structure) have been determined, the structure of the aforementioned liquid silk (hereinafter referred to as Silk I structure) and the configuration of fibrillation based on it are still unclear , Moreover, high-strength synthetic silk-like fibers cannot be obtained. [0003] For example, Zhou et al. have reported the ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): C07K14/435C12N15/12D01F4/00
CPCD01F4/00C07K14/43586C07K14/435
Inventor朝仓哲郎
OwnerJAPAN OF RESPRESENTED BY PRESIDENT OF TOKYO UNIVERTY OF AGRI & TECH