Tissue factor pathway inhibitor (TFPI), preparation method thereof and application thereof
A technology of tissue factor and inhibitor, applied in the field of tissue factor pathway inhibitor and its preparation and application, can solve the problems such as unclear specific mechanism, and achieve the effect of inhibiting bacterial infection and highly effective antibacterial effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0029] The tissue factor pathway inhibitor TFPI-1 is shown in the amino acid sequence of SEQ ID No. 1 in the sequence listing; the tissue factor pathway inhibitor TFPI-2 is shown in the amino acid sequence of SEQ ID No. 2 in the sequence listing.
[0030] The sequence listing SEQ ID No.1 is:
[0031] MAPVKWWILCAVLLCCVPRFGSCRRDRQADGPLPELFIFNELCALKDEPGPCKAIKDRFFFNVDTGHCELFEYGGCGGNA
[0032] NNFETLEDCEETCVVSDNKNPCHLAEAPGPCRGLVTRYFFDSGSQQCKHFYYGGCFGNANNFKSMAECQAKCQNPENPTK
[0033] APEVHTQPAGKSNVVQPTILTGEMTVSEPQVQTNETHKNPKVLRPTELCFDPVDRGTCQGSEKRFAYNPITKRCHAFSYS
[0034] GCGGNRNNFAYRKDCMIKCRRRKVHGPMIRIRKKNLDNILHRSI
[0035] (a) Sequence features:
[0036] ●Length: 284
[0037] ●Type: amino acid sequence
[0038] ●Chain type: single chain
[0039] ●Topological structure: linear
[0040] (b) Molecule type: protein
[0041] (c) Assumption: No
[0042] (d) Antisense: no
[0043] (e) Original source: American Redfish
[0044] Structural features: The most obvious structural fe...
Embodiment 2
[0060] Preparation method of tissue factor pathway inhibitor TFPI-1 and TFPI-2:
[0061] 1) Construction of plasmid pE15TFPI1:
[0062] Using American redfish cDNA as a template, PCR amplification was performed with primers TP1F1 and TP1R1. The PCR conditions were: 94°C for 60s to pre-denature the template DNA, then 94°C for 40s, 52°C for 60s, 72°C for 60s, after 5 cycles, change to 94°C for 40s, 58°C for 60s, 72°C for 60s, after 25 cycles and then at 72°C. ℃ extension reaction 7-10min. After the PCR product was purified, it was ligated with the carrier pBS-T (purchased from "Tiangen Biochemical Technology (Beijing) Co., Ltd.") at room temperature for 2-8 hours, and the ligation mixture was transformed into E. ml Xgal and isopropyl-β-D-thiogalactoside (24ug / ml) were cultured on LB medium for 18-24 hours, and the transformants were screened to extract a plasmid, which was plasmid pBSTP1.
[0063] The above-mentioned plasmid pBSTP1 and plasmid pET259 (see Zheng, W.J., Hu, Y.H...
Embodiment 3
[0074] Application of Tissue Factor Pathway Inhibitors TFPI-1 and TFPI-2
[0075] 1) Preparation of Edwardsiella tarda. Cultivate Edwardsiella tarda TX1 (preserved in CGMCC, numbered as CGMCC No.2330) in LB medium to OD 600 0.5, and then centrifuged (5000g, 4°C) for 10min. Collect the cells and suspend them in PBS to a final concentration of 1x10 5 cfu / ml.
[0076] The composition of PBS is by weight percentage: 0.8% NaCl, 0.02% KCl, 0.358% Na 2 HPO 4 .12H 2 O, 0.024% NaH 2 PO 4 .
[0077] 2) Bactericidal effects of tissue factor pathway inhibitors TFPI-1 and TFPI-2. Mix 20 ul of the bacteria solution from the above step 1) with 0.5 uM TFPI-1, TFPI-2 and PBS (control) prepared in Example 2 respectively, and incubate at 25° C. for 3-5 h. Then the mixture was spread on LB solid plates and cultured at 28°C for 32-48h. Colony counts revealed that TFPI-1 and TFPI-2 treatment resulted in about 90% reduction in bacterial numbers compared to PBS, ie about 90% of bacteria we...
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com