Increased production of aspartic proteases in filamentous fungal cells

A filamentous fungus and cell technology, applied in the field of increasing the production of aspartic protease in filamentous fungal cells, can solve the problems of interfering with the effective production of heterologous proteins and the like

Inactive Publication Date: 2011-06-15
DANISCO US INC
View PDF29 Cites 7 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0008] However, the occurrence of protein degradation can interfere with the efficient production of heterologous proteins in genetically engineered cells

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Increased production of aspartic proteases in filamentous fungal cells
  • Increased production of aspartic proteases in filamentous fungal cells
  • Increased production of aspartic proteases in filamentous fungal cells

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0253] Construction of recombinant pepAa gene and production of PEPAa by the transformed GAP3 strain of Aspergillus niger protein

[0254] The pepAa gene encodes a 424 amino acid PEPAa protein (SEQ ID NO: 1), which has a 19 amino acid signal sequence. This example illustrates: (1) Construction of the plasmid vector pGAMD-pepAa, which has a recombinant gene of pepAa inserted between the Aspergillus niger glucoamylase promoter and the Aspergillus tubing glucoamylase terminator; (2) The vector was used to transform Aspergillus niger to obtain the integrated recombinant gene; (3) selecting Aspergillus niger strains overexpressing pepAa; and (4) measuring the PEPAa protein production of the overexpressing strains.

[0255] In order to construct the recombinant expression plasmid of the Aspergillus niger pepAa gene, two primers CACTCGAGGCCACCATGCAGCTCCTCCAG (SEQ ID NO: 5) and AGGAAACTAGTTCTTGGGAGAGGCAAC (SEQ ID NO: 6) were used in the Pfu PCR reaction containing the genomic DNA templat...

Embodiment 2

[0275] Construct the recombinant truncated pepAa gene and transform it into the GAP3 strain of Aspergillus niger

[0276] Preparation of recombinant truncated form of pepAa gene ("pepAa * ”) and transformed into the GAP3 strain of Aspergillus niger to prove the importance of this sequence for the secretion of the full-length wild-type PEPAa protein (SEQ ID NO:1). The full-length pepAa gene has the coding position 382 in SEQ ID NO:1 The 3'nucleotide sequence of the following C-terminal amino acid starting at:

[0277] LCFGGIQSNGNTSLQILGDIFLKAFFVVFDMRGPSLGVASPKN.

[0278] Such as Figure 24 Shown by pepAa * Encoded PEPAa * The amino acid sequence of the truncated form of the protein (SEQ ID NO: 23) does not have the C-terminal 43 amino acids of SEQ ID NO: 1, but has 13 different amino acids inserted. Therefore, PEPAa and PEPAa * The amino acid sequence at positions 1-381 are the same, but starting from position 382, ​​PEPAa * The sequence (SEQ ID NO: 23) has a C-terminal amino acid: ...

Embodiment 3

[0284] Construction of recombinant pepAb gene and production of PEPAb egg by transformed Aspergillus niger GAP3 strain White matter

[0285] The recombinant expression plasmid of the Aspergillus niger pepAb gene was constructed as described for the pepAa gene in Example 1, except that the two primers used in the Pfu PCR reaction containing the genomic DNA template obtained from the UVK143 strain were AACTCGAGTCCATCATGGCTACCAAAATC (SEQ ID NO: 10 ) And CCTCTAGACTACTCCGACTTCAGGCTC (SEQ ID NO: 11). The 1418bp nucleotide sequence of the resulting PCR amplicon (SEQ ID NO: 12) is shown in Picture 10 in.

[0286] The PCR amplicon (SEQ ID NO: 12) was cloned into the pGAMD vector (as described for pepAa amplicon in Example 1). The resulting plasmid pGAMD-pepAb (shown in Picture 11 Medium) contains a recombinant gene including pepAb inserted between the Aspergillus niger glucoamylase promoter and the Aspergillus tubing glucoamylase terminator.

[0287] As in Example 1, the pGAMD-pepAb pla...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

Described are compositions and methods relating to filamentous fungal cells genetically engineered to provide increased production of aspartic proteases, such as PEPAa, PEPAb, PEPAc, and PEPAd. Also described are nucleic acids and methods for making the engineered filamentous fungal cells.

Description

[0001] priority [0002] This application claims priority for US Provisional Patent Application Serial No. 61 / 084,491 filed on July 29, 2008, which is hereby incorporated by reference in its entirety. Technical field [0003] The compositions and methods of the present invention relate to filamentous fungal cells that have been genetically modified to provide increased production of aspartic proteases, including PEPA homologs: PEPAa, PEPAb, PEPAc, and PEPAd. Background of the invention [0004] Genetic modification has allowed improvements in microorganisms used in industrial bioreactors, cell factories, and food fermentation. The important enzymes and proteins produced by the modified microorganisms include glucoamylase, α-amylase, cellulase, neutral protease and alkaline (or serine) protease, hormones and antibodies. [0005] For example, enzymes with granular starch hydrolysis (GSH) activity, such as glucoamylase, are important industrial enzymes for the production of compounds su...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C12N9/62C12N9/64
CPCC12N9/2428C12N9/6481C12N9/62
Inventor王华明
OwnerDANISCO US INC