A kind of construction method and application of sirpa humanized animal model
An animal model, humanized technology, applied in the field of animal genetic engineering and genetic modification, can solve the problem of incomplete testing of antibodies in humans, and achieve the effect of high success rate
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0036] Example 1: Establishment of SIRPA humanized mouse model
[0037] Using CRISPR Cas9 to replace the mouse Sirpa gene with human SIRPA on C57BL / 6 background and BALB / c background mice, thereby constructing a mouse model that can express human SIRPA. And by mating with PD1 humanized mice with independent property rights, a dual-human mouse model that can express human SIRPA and PD1 was obtained.
[0038] 1. Determine the replacement region of the human fragment and the inserted human sequence
[0039] According to the structure and function of human SIRPA, we selected the extracellular region encoded by the human SIRPA gene to replace the extracellular region encoded by the mouse Sirpa gene, retained the intracellular region of the mouse, and selected the extracellular region encoded by the human SIRPA gene The amino acid sequence (Aa: 28-362) is shown in SEQ No.1.
[0040] GVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFP RVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRK...
Embodiment 2B6
[0074] Embodiment 2B6-hSIRPA and BALB / c-hPD1 / hSIRPA mice Human SIRPA expression and immune system verification
[0075] The expression of SIRPA homozygous mice was analyzed by flow cytometry and the immune cell populations were checked. After analysis, the mice that could successfully express the humanized gene and did not cause obvious abnormalities in the immune system were available for tumor drug efficacy experiments.
[0076] 1. Protein expression detection
[0077] The thymus or spleen, which mainly expresses SIRPA, was selected to detect the expression of SIRPA protein in the tissues.
[0078] SIRPA protein flow detection method:
[0079] a) Material collection: Spleen of humanized mouse and background mouse were cut out, weighed, and placed in a C-tube.
[0080] b) Digestion: Enzyme digestion solution (PBS containing Ca, Mg+2% CS+10mM HEPES+30ugDNase+1.75mg collagenase D) was used to digest spleen and thymus for 30min at 37°C. Add 300ul of 0.1M EDTA to the digested ...
Embodiment 3B6
[0094] Example 3B6-hSIRPA humanized mice evaluate the tumor efficacy verification of anti-SIRPA antibodies
[0095] Since the verification data at the in vitro level is not enough to reflect the actual situation of hSIRPA in humanized mice, the present invention designs experiments to collect the following in vivo experimental data: Tumor-bearing B6-hSIRPA humanized mice anti-hSIRPA antibody anti-tumor drug Responsiveness and anti-tumor pharmacodynamic reactivity of anti-hSIRPA antibody combined with anti-mPDL1 antibody.
[0096] Detection method: MC38-hCD47 (murine CD47 humanized MC38 tumor cell line) cell culture. Resuscitated cells: Take them out of the liquid nitrogen tank, thaw them quickly in a 37°C water bath, inoculate them in a 15cm dish and culture them. Subculture: MC38-hCD47 is an adherent cell, and usually needs to be subcultured every 2-3 days. Subcutaneous injection of MC38-hCD47 cells: collect the cells, centrifuge at 1000 rpm for 5 min, discard the supernata...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


