Preparation method and application of bispecific antibody targeting mouse T lymphocyte CD3 and human tumor antigen HER2
A bispecific antibody and target cell technology, which is applied in the direction of anti-receptor/cell surface antigen/cell surface determinant immunoglobulin, antibody, anti-tumor drug, etc., can solve the problem of limited curative effect of solid tumors, and achieve increased immunity Therapy, efficacy enhancement effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0067] Example 1: Preparation of bispecific antibody (HER2×mCD3, M806)
[0068] 1. Bispecific antibody sequence design
[0069] The bispecific antibody targeting HER2 and mCD3 (clone number: 2C11) was named M806, as image 3 As shown, the anti-HER2 is in the form of IgG, including anti-HER2 heavy chain and light chain, and the anti-mCD3 is in the form of ScFv-Fc, including anti-mCD3 VH, VL, and Fc domains.
[0070] Anti-HER2 heavy chain (amino acid sequence SEQ ID NO.1)
[0071] EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYDTTPPVLDSDGSFFLYSDLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[0072] Anti-HER2 light chain (amino acid sequence SE...
Embodiment 2
[0091] Example 2: Preparation of mouse tumor cell lines expressing human tumor antigen HER2
[0092] 1. Murine Tumor Cell Preparation
[0093] B16 mouse melanoma cells and CT26.WT mouse colon cancer cells were purchased from the Cell Bank of the Cell Resource Center, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences.
[0094] 2. Acquisition of antigen gene and construction of expression vector
[0095] The cultured SK-BR-3 cells (ATCC, HTB-30) expressing human HER2 were collected, centrifuged at 400×g for 5 min, and the supernatant was discarded. Add the same volume of PBS as the culture medium before centrifugation, resuspend the pellet, centrifuge at 400×g for 2-3 minutes, and discard the supernatant. Using Invitrogen's The reagent kit (15596-026) was operated according to the instructions to extract the total RNA of the cells.
[0096] Firstly, random primers in the 5'RACE FULL kit (purchased from TAKARA, product number D315) of Takara Company ...
Embodiment 3
[0108] Example 3: In Vitro Cell Killing Detection
[0109] 1. Mouse Splenocyte Preparation
[0110] Bluntly dissect the mouse spleen, inject PBS repeatedly into the spleen with a syringe, collect the outflowing spleen cell suspension, centrifuge at 400×g for 10 minutes, resuspend the pellet in PBS, and act with 5 times the volume of red blood cell lysate (beyotime, C3702) for 5 minutes Centrifuge at 400×g for 5 minutes, wash once with PBS and resuspend the cells in 10% FBS-1640 medium to 1×10 6 cells / ml, spare.
[0111] 2. Preparation of murine tumor cells expressing human tumor antigens
[0112] B16-HER2 / CT26-HER2 cells were cultured in RPMI-1640 (GIBCO, C11875) + 10% FBS (BI, 04-001-1A). After culture, the cells were digested with 0.25% trypsin and detected by Vi-Cell cell counter Cell number and viability, collect the cells and centrifuge to remove the supernatant, resuspend in 1% FBS-PBS to make a single cell suspension, stain with CFSE at a final concentration of 5 μ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com
