Preparation method of water-soluble Sargassum fusiforme polysaccharides
A technology for water-soluble polysaccharide and hijiki, applied in the field of polysaccharide extraction, can solve problems such as unfavorable polysaccharide extraction rate, unsatisfactory cell wall breaking, etc., achieve immunomodulatory biological function, shorten extraction time, improve yield and activity Effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0013] A method for preparing a water-soluble polysaccharide from hijiki, comprising: ultrasonic leaching of the polysaccharide, protein removal, alcohol precipitation and drying, and the specific operation steps are:
[0014] (1) The steps of ultrasonic leaching of polysaccharides are: add hijiki coarse powder to 0.8% NaCl solution, which is 0.04% active polypeptide by weight of the coarse powder. The amino acid sequence of the active polypeptide is: MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGYRGLCRFCAQYFVGHHGCPRRYRCCAIRA. Ultrasonic treatment after mixing, the temperature of ultrasonic treatment is 4°C, the time is 2.5h, placed at 3°C for 6h, and the filtrate is centrifuged at 4°C at 7000rpm for 20min, and the supernatant is obtained to obtain a crude protein solution. The peptide is hydrophilic and lipophilic. The hydrophilicity makes it soluble in distilled water, and the lipophilicity makes it combine with the cell membrane of Spirulina, forming small holes under the cell membrane, r...
Embodiment 2
[0018] A method for preparing a water-soluble polysaccharide from hijiki, comprising: ultrasonic leaching of the polysaccharide, protein removal, alcohol precipitation and drying, and the specific operation steps are:
[0019] (1) The steps of ultrasonic leaching of polysaccharides are: add hijiki coarse powder to 1% NaCl solution to obtain 0.04% active polypeptide by weight of the coarse powder. The amino acid sequence of the active polypeptide is: MKGLSFVLLVLLLMPDGEGTDPEMQYWTCGYRGLCRFCAQYFVGHHGCPRRYRCCAIRA. Ultrasonic treatment after mixing, the temperature of ultrasonic treatment is 3°C, the time is 3h, placed in 5°C for suction filtration for 8h, the filtrate is centrifuged at 5°C at 6000rpm for 20min, the supernatant is taken to obtain a crude protein solution, the active peptide It is hydrophilic and lipophilic. The hydrophilicity makes it soluble in distilled water. The lipophilicity makes it combine with the cell membrane of Spirulina, forming small holes under the cell...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com