Swill oil emulsion flooding system
A technology of emulsion and waste oil, which is applied in the direction of drilling composition, chemical instruments and methods, etc., can solve the problems of unsatisfactory oil recovery rate, unsatisfactory deep profile control and displacement effect, high preparation cost, etc., and achieve Achieve selective plugging, reduce tension, and increase oil displacement efficiency
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0015] Waste oil emulsion control and flooding is a water-in-oil emulsion formed by mixing surfactants with HLB value less than 6 and swill oil.
[0016] The preparation method of gutter oil emulsion regulation and flooding comprises the following steps: adding pretreated swill oil or swill oil sold in the market to an emulsifier solution, and then adding an active polypeptide. The amino acid sequence of the active polypeptide is HSHACTKCSYYCAKFCGTAKCTHYLCRVLHPGKLCVCVNCSK. After mixing, use an ultrasonic homogenizer to prepare a water-in-oil emulsion. The above-mentioned active polypeptide has good compatibility with swill oil and emulsifier, and the active polypeptide is attached to the molecular surface of water-in-oil emulsion formed by swill oil and emulsifier, which can significantly enhance the hydrophobicity of water-in-oil emulsion and improve Water blocking properties of water-in-oil emulsions. To measure the size distribution, stability and interfacial tension of th...
Embodiment 2
[0019] Prepare a fatty acid sorbitan solution with a mass fraction of 0.5%, mix it with commercially available swill oil at a volume ratio of 7:3, and then add an active polypeptide. The amino acid sequence of the active polypeptide is HSHACTKCSYYCAKFCGTAKCTHYLCRVLHPGKLCVCVNCSK. After mixing, use an ultrasonic homogenizer to prepare a water-in-oil emulsion. The above-mentioned active polypeptide has good compatibility with swill oil and emulsifier, and the active polypeptide is attached to the molecular surface of water-in-oil emulsion formed by swill oil and emulsifier, which can significantly enhance the hydrophobicity of water-in-oil emulsion and improve Water blocking properties of water-in-oil emulsions. To measure the size distribution, stability and interfacial tension of the emulsion, the average particle size of the emulsion is required to be larger than the average radius of the pore throat of the target reservoir, and the emulsion can maintain a water separation rat...
Embodiment 3
[0021] Prepare a polyglyceryl stearate solution with a mass fraction of 0.5% and an HLB value less than 6, mix it with the pretreated swill oil at a volume ratio of 7:3, and then add an active polypeptide whose amino acid sequence is HSHACTKCSYYCAKFCGTAKCTHYLCRVLHPGKLCVCVNCSK. After mixing, use an ultrasonic homogenizer to prepare a water-in-oil emulsion. The above-mentioned active polypeptide has good compatibility with swill oil and emulsifier, and the active polypeptide is attached to the molecular surface of water-in-oil emulsion formed by swill oil and emulsifier, which can significantly enhance the hydrophobicity of water-in-oil emulsion and improve Water blocking properties of water-in-oil emulsions. To measure the size distribution, stability and interfacial tension of the emulsion, the average particle size of the emulsion is required to be larger than the average radius of the pore throat of the target reservoir, and the emulsion can maintain a water separation rate ...
PUM
Property | Measurement | Unit |
---|---|---|
interfacial tension | aaaaa | aaaaa |
quality score | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com