Swill oil emulsion flooding system

A technology of emulsion and waste oil, which is applied in the direction of drilling composition, chemical instruments and methods, etc., can solve the problems of unsatisfactory oil recovery rate, unsatisfactory deep profile control and displacement effect, high preparation cost, etc., and achieve Achieve selective plugging, reduce tension, and increase oil displacement efficiency

Inactive Publication Date: 2018-03-09
ZHEJIANG OCEAN UNIV
View PDF8 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The above control and flooding system can expand in high temperature and high salinity brine, and has good stability. However, the preparation cost of the control system is relatively high, and the effects of water plugging, deep profile control and displacement are not ideal, and the recovery of crude oil remains to be seen. improve

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0015] Waste oil emulsion control and flooding is a water-in-oil emulsion formed by mixing surfactants with HLB value less than 6 and swill oil.

[0016] The preparation method of gutter oil emulsion regulation and flooding comprises the following steps: adding pretreated swill oil or swill oil sold in the market to an emulsifier solution, and then adding an active polypeptide. The amino acid sequence of the active polypeptide is HSHACTKCSYYCAKFCGTAKCTHYLCRVLHPGKLCVCVNCSK. After mixing, use an ultrasonic homogenizer to prepare a water-in-oil emulsion. The above-mentioned active polypeptide has good compatibility with swill oil and emulsifier, and the active polypeptide is attached to the molecular surface of water-in-oil emulsion formed by swill oil and emulsifier, which can significantly enhance the hydrophobicity of water-in-oil emulsion and improve Water blocking properties of water-in-oil emulsions. To measure the size distribution, stability and interfacial tension of th...

Embodiment 2

[0019] Prepare a fatty acid sorbitan solution with a mass fraction of 0.5%, mix it with commercially available swill oil at a volume ratio of 7:3, and then add an active polypeptide. The amino acid sequence of the active polypeptide is HSHACTKCSYYCAKFCGTAKCTHYLCRVLHPGKLCVCVNCSK. After mixing, use an ultrasonic homogenizer to prepare a water-in-oil emulsion. The above-mentioned active polypeptide has good compatibility with swill oil and emulsifier, and the active polypeptide is attached to the molecular surface of water-in-oil emulsion formed by swill oil and emulsifier, which can significantly enhance the hydrophobicity of water-in-oil emulsion and improve Water blocking properties of water-in-oil emulsions. To measure the size distribution, stability and interfacial tension of the emulsion, the average particle size of the emulsion is required to be larger than the average radius of the pore throat of the target reservoir, and the emulsion can maintain a water separation rat...

Embodiment 3

[0021] Prepare a polyglyceryl stearate solution with a mass fraction of 0.5% and an HLB value less than 6, mix it with the pretreated swill oil at a volume ratio of 7:3, and then add an active polypeptide whose amino acid sequence is HSHACTKCSYYCAKFCGTAKCTHYLCRVLHPGKLCVCVNCSK. After mixing, use an ultrasonic homogenizer to prepare a water-in-oil emulsion. The above-mentioned active polypeptide has good compatibility with swill oil and emulsifier, and the active polypeptide is attached to the molecular surface of water-in-oil emulsion formed by swill oil and emulsifier, which can significantly enhance the hydrophobicity of water-in-oil emulsion and improve Water blocking properties of water-in-oil emulsions. To measure the size distribution, stability and interfacial tension of the emulsion, the average particle size of the emulsion is required to be larger than the average radius of the pore throat of the target reservoir, and the emulsion can maintain a water separation rate ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
interfacial tensionaaaaaaaaaa
quality scoreaaaaaaaaaa
Login to View More

Abstract

The invention discloses a microemulsion flooding system prepared by taking swill oil as a raw material. The flooding system is prepared from swill oil pretreatment fluid, and anionic, non-ionic or composite surface active agent of which HLB value is less than 6. The microemulsion flooding system has the beneficial effects that the raw materials are emulsified to form oil-coating-water type emulsion, and its emulsion droplet size is designed according to the hole size of the injection oil deposit. The generally designed droplet size is more than that of a pore throat, thus the emulsion can effectively block the pore throat and generate a Jamin effect, thus the subsequent fluid is changed, and the volume is further enlarged. Meanwhile, it is the oil-coating-water type emulsion, the emulsiongenerates big flow resistance in the face with water, and has small flow resistance change in the face with oil, thus the microemulsion flooding system plays the effects of selective water blocking and flooding since only water is blocked. Therefore, the flooding system can selectively block water and recycle the swill oil.

Description

technical field [0001] The invention relates to the field of oil and gas exploitation, in particular to the regulation and flooding of waste oil emulsion. Background technique [0002] Swill oil, commonly known as gutter oil, is a variety of low-quality oils produced in human life. After high-temperature cooking, a variety of carcinogens have been formed and can no longer be eaten. But because it is neither edible, it is a pity to discard it. If it is converted into an industrially usable substance, it can not only turn waste into wealth, but also prevent it from flowing back into the catering industry. [0003] At the same time, in the development of oilfields by water injection, water output from oil wells is a common problem, and channeling of injected fluids is a problem that needs to be solved. It is very necessary to timely and accurately find out the aquifer and the direction of water production, and take measures of profile control and water shutoff. At present, t...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C09K8/584C09K8/502
CPCC09K8/584C09K8/502
Inventor褚天舒殷丹丹赵东锋刘伟
OwnerZHEJIANG OCEAN UNIV