Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Application of combination of IGF1 and IGF1Ec24 in preparation of medicine for promoting tissue repair and regeneration

A tissue repair and drug technology, applied in the field of biomedicine to achieve the effect of promoting tissue repair and tissue regeneration

Pending Publication Date: 2020-05-26
CHONGQING UNIV
View PDF2 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, it has not been reported whether IGF1 and IGFEC24 are active in combination with two separate proteins

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Application of combination of IGF1 and IGF1Ec24 in preparation of medicine for promoting tissue repair and regeneration
  • Application of combination of IGF1 and IGF1Ec24 in preparation of medicine for promoting tissue repair and regeneration
  • Application of combination of IGF1 and IGF1Ec24 in preparation of medicine for promoting tissue repair and regeneration

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0025] Embodiment 1, amino acid synthesis

[0026] Synthesize IGF1, IGFEC24, IGF1Ec and IGF1-24 respectively, IGF1 is human insulin-like growth factor 1, and its amino acid sequence is shown in GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAP LKPAKSA (SEQ ID NO.1); IGFEC24 is human insulin growth factor Ec24 peptide, and its amino acid sequence is: YQPPSTRKNTQ ID NO.2); IGF1Ec is composed of 110 amino acids, of which the 70 amino acid sequences at the amino terminal are identical to IGF1, and the 24 amino acid sequences at the carboxy terminal are identical to the IGF1Ec24 peptide. ; IGF1-24 is composed of 97 amino acids, of which 70 amino acid sequences at the amino terminal are identical to IGF1, and 24 amino acid sequences at the carboxyl terminal are identical to IGFEc24 peptide, and are connected by 3 Gly linkers in the middle. NO.4).

Embodiment 2

[0027] Embodiment 2, activity verification

[0028] Adult female SD rats were divided into 5 groups, PBS group, IGF1 group, IGF1Ec group, IGF1-24 group, IGF1+IGF1Ec24 peptide group, with 3 rats in each group. The rats in each group were distinguished by ear cutting for subsequent protein injection according to the different body weights of the rats.

[0029] Rats in each group were injected with PBS, IGF1, IGF1Ec24 peptide, IGF1Ec and IGF1-24 for 7 consecutive days. The recombinant protein IGF1-24 was injected at 100 μg / kg, and the injection of other histones was converted according to the molar amount of IGF1-24 injection, which were: 90 μg / kg for IGF1, 8.9 μg / kg for IGF1Ec24 peptide, and 104 μg / kg for IGF1Ec. kg.

[0030] Before injecting the protein, the rats were first weighed with a platform scale, and the body weight and the injection volume of the converted protein were recorded; then the rat was fixed with a rat fixer and the tail was exposed, and the rat tail was so...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses an application of a combination of IGF1 and IGF1Ec24 in preparation of a medicine for promoting tissue repair and regeneration. Research finds that the combined application ofIGF1 and IGF1Ec24 can promote the proliferation of myocardial cells, nerve cells and skeletal muscle cells with final terminal differentiation so as to achieve the effects of supplementing tissue neoplastic cells and promoting tissue repair and tissue regeneration; and a new thought is provided for treatment of tissue repair and regeneration, and the application can be used for developing medicines for clinically treating neurodegenerative diseases including Alzheimer's disease, myocardial infarction, amyotrophy, central nervous and peripheral nerve injury and the like.

Description

technical field [0001] The invention relates to the field of biomedicine, in particular to the application of IGF1 and IGF1Ec24 in the preparation of drugs for promoting tissue repair and regeneration. Background technique [0002] Various tissues of lower animals have strong regenerative ability, while higher animals have weak regenerative ability. Human terminally differentiated cells, including nerve cells, cardiomyocytes, and skeletal muscle cells, lose their proliferative function rapidly after birth. Once damaged, it becomes permanently lost. Therefore, when a person suffers from neurodegenerative diseases, myocardial infarction, muscle atrophy and other diseases, the damaged cells cannot be repaired, resulting in the failure to restore the function of this part of the organ. [0003] Neurodegenerative diseases are characterized by progressive loss of neuronal structure and function, including Alzheimer's disease (AD), Parkinson's disease (PD), multiple sclerosis (MS...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
IPC IPC(8): A61K38/30A61P25/28A61P9/10A61P21/00A61P25/00A61P25/02A61P25/16
CPCA61K38/30A61P25/28A61P9/10A61P21/00A61P25/00A61P25/02A61P25/16A61K2300/00
Inventor 唐丽灵王星孙慧芳刘飘洋徐锡超陈影张露梁媛媛
Owner CHONGQING UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com