Elastic targeting polypeptide-based medicine-carrying nanoparticle as well as preparation method and application thereof
A technology targeting peptides and drug-loaded nanometers, which is applied in the field of medicine, can solve the problems of large side effects and poor targeting selectivity of anticancer drugs, and achieve the effects of high drug loading rate, expansion and efficacy, and small dispersion
- Summary
- Abstract
- Description
- Claims
- Application Information
 AI Technical Summary 
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0018] Example 1: Preparation of Elastic Targeting Polypeptide ABD-iTEP70-(GGGGC)8
[0019] First design the amino acid sequence ABD and iTEP, and then use the existing peptide synthesis method to prepare
[0020] ABD-(iTEP)70-(GGGGC)8, where
[0021] ABD amino acid sequence: LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP
[0022] Amino acid sequence of iTEP: GAGVPG
[0023] After the gene encoding the elastic targeting polypeptide ABD-(iTEP)70-(GGGGC)8 was synthesized, it was digested and inserted into the modified pET25b(+) vector to construct a recombinant expression plasmid; the gene sequence was successfully prepared after sequencing.
Embodiment 2
[0024] Example 2: Preparation of Elastic Targeting Polypeptide ABD-(iTEP)70-(GGGGGGC)8
[0025] First design the amino acid sequences ABD and iTEP, and then prepare ABD-(iTEP)70-(GGGGGGC)8 using the existing peptide synthesis method, wherein
[0026] ABD amino acid sequence: LAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALP
[0027] Amino acid sequence of iTEP: GAGVPG
[0028] After the gene encoding the elastic targeting polypeptide ABD-(iTEP)70-(GGGGGGC)8 was synthesized, it was digested and inserted into the modified pET25b(+) vector to construct a recombinant expression plasmid; its gene sequence was successfully prepared after sequencing.
Embodiment 3
[0029] Example three: Synthesis of modified paclitaxel PTX-LEV-MECH
[0030]
[0031] Synthesis of Compound 1: Dissolve hydrazine hydrate (20.0 g, 0.40 mmol) in 80 mL of isopropanol at 0° C., then add di-tert-butyl dicarbonate (43.6 g, 0.20 mmol) to the solution, and dissolve the reaction solution The temperature was raised to room temperature, stirred for 1 hour, the solvent was removed, the residue was dissolved in dichloromethane, the insoluble matter was removed by filtration, and the organic phase was concentrated to obtain compound 1 (19.4 g, 74% yield) as a white solid. 1 H NMR (400MHz, CDCl 3 )δ1.46(s, 9H)
[0032] Synthesis of Compound 2: Maleic anhydride (5.00 g, 51.0 mmol) was dissolved in 100 mL of acetic acid at 0° C., and then 6-aminocaproic acid (6.69 g, 51.0 mmol) was slowly added to the above solution. The reaction solution was warmed up to room temperature and stirred for 4 hours. Subsequently, the reaction solution was heated to reflux overnight. Unde...
PUM
| Property | Measurement | Unit | 
|---|---|---|
| The average particle size | aaaaa | aaaaa | 
| The average particle size | aaaaa | aaaaa | 
Abstract
Description
Claims
Application Information
 Login to View More
 Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com



