New coronavirus SARS-CoV-2 broad-spectrum polypeptide antigen, specific neutralizing antibody thereof and application
A polypeptide antigen, sars-cov-2 technology, applied in the direction of viral peptides, viruses/phages, antibodies, etc., can solve problems such as the lack of broad-spectrum vaccines and rapid detection methods for detecting anti-S2 antibodies.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0057] A new coronavirus SARS-CoV-2 broad-spectrum polypeptide antigen determination and antigen-specific detection method
[0058] Using biological software to analyze the amino acid sequence of the S2 protein of SARS-CoV-2, from the hydrophilicity, antigenic index, surface site index and the conserved possible antigenic fragment of the S2 protein, the amino acid sequence is DPLQPELDSFKEELDKYFKNHTSPDVDLGDIS (SEQ ID NO: 1) The polypeptide. After comparison, the peptide shown in SEQ ID NO: 1 has no change in the S protein of SARS, SARS-CoV-2 of the β-coronavirus genus, and all variants of SARS-CoV-2 found so far.
Embodiment 2
[0060] 1. Preparation of ELISA detection kit using polypeptide antigen
[0061] The polypeptide antigen preparation kit described in Example 1 is composed as follows:
[0062] 1. ELISA plates coated with polypeptide antigens;
[0063] 2. Enzyme-labeled antibody: horseradish peroxidase-labeled mouse anti-human IgG;
[0064] 3. Substrate solution preparation: 100mmol / L citric acid solution (21g citric acid dissolved in deionized water, dilute to 1L) 24.3mL, 200mmol / L Na 2 HPO 4 12H 2 O (71.6g Na 2 HPO 4 12H 2 O (dissolved in deionized water, dilute to 1L) 25.7mL and mix well, add 50mg of tetramethylbenzidine (TMB), add 50μL of 30% H 2 o 2 .
[0065] 4. Stop solution 2M H 2 SO 4 : Take 89 mL of distilled water and concentrated H 2 SO 4 11 mL to mix.
[0066] 5. Washing solution: add 0.5mL Tween-20 to 1000mL 10mmo1 / L PBS with pH 7.4;
[0067] 6. Negative control (human negative serum) and positive control (human SARS-CoV-2 inactivated positive serum).
[0068] 2. Pre...
Embodiment 3
[0078] A kind of preparation method of SARS-CoV-2 triple broad-spectrum polypeptide tandem fusion protein
[0079] 1) Design and amplify the primers containing the pColdⅠ linearization vector and 3 corresponding gene fragments containing SEQ ID NO: 1: the upstream primer for amplifying the pColdⅠ linearization vector is located at positions 337-361 of the pColdⅠ plasmid; the downstream primer for amplifying the pColdⅠ linearization vector is located at Positions 295-318 of the pColdI plasmid. The amplified fragment gene containing SEQ ID NO: 1 is located at position 3415-3510 of the SARS-CoV-2S gene; the upstream primer for amplifying the first fragment has 15 reverse complementary primers downstream of the pColdⅠ linearized vector at the 5' end Base, the downstream then adds the reverse complementary sequence with the corresponding base of expressing Linker GGGGS; The upstream and downstream primers of the amplification second fragment add the corresponding base sequence and ...
PUM

Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com