Antibody to periostin and its application in drug preparation

A periostin and antibody technology, which is applied in the direction of antibodies, drug combinations, preparations for in vivo tests, etc., can solve the problems that the effect has not been reported yet, and achieve the effect of improving the development of NAFLD and reducing the content of TG

Active Publication Date: 2016-01-27
RUIJIN HOSPITAL AFFILIATED TO SHANGHAI JIAO TONG UNIV SCHOOL OF MEDICINE
View PDF1 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

According to current research, the expression of Periostin is up-regulated in various pathological conditions, including bone metastasis of colon cancer and breast cancer, etc., but the role of Periostin in NAFLD and hyperlipidemia has not been reported yet

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antibody to periostin and its application in drug preparation
  • Antibody to periostin and its application in drug preparation
  • Antibody to periostin and its application in drug preparation

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0051] C57BL / 6 mice were divided into two groups, one group was fed with high-fat for 12 weeks, and the other group was fed with low-fat for 12 weeks. By gene expression profiling chip technology, the mice in the high-fat group and low-fat group were compared. Differences in gene expression in mouse liver, from which it was found that in the liver of obese mice induced by high-fat diet, the expression was significantly up-regulated (pfigure 1 As shown; for leptin receptor-deficient db / db obese mice and leptin-deficient ob / ob obese mice, the expression of Periostin in the liver of two groups of obese mice was significantly up-regulated, specifically as figure 2 Shown; in fatty liver patients, the expression of Periostin was significantly increased, and showed a significant positive correlation with liver TG content, see image 3 shown.

[0052] The experiment uses the adenovirus-mediated overexpression system to specifically overexpress Periostin in the liver of C57BL / 6 mice. ...

Embodiment 2

[0056] Periostin antibody production process.

[0057] 1), the amino acid sequence of mouse Periostin protein (as shown in SEQIDNo.1) is:

[0058] 1mvpllplyallllflcdinpanansyydkvlahsrirgrdqgpnvcalqqilgtkkkyfs

[0059] 61scknwyqgaicgkkttvlyeccpgymrmegmkgcpavmpidhvygtlgivgatttqhysd

[0060] 121vsklreeiegkgsytyfapsneawenldsdirrglennvnvellnalhshmvnkrmltkd

[0061] 181lkhgmvipsmynnlglfinhypngvvtvncarvihgnqiatngvvhvidrvltqigtsiq

[0062] 241dfleaeddlssfraaaitsdlleslgrdghftlfaptneafeklprgvlerimgdkvase

[0063] 301almkyhilntlqcseaitggavfetmegntieigcegdsisingikmvnkkdivtkngvi

[0064] 361hlidevlipdsakqvielagkqqttftdlvaqlglasslkpdgeytllapvnnafsddtl

[0065] 421smdqrllklilqnhilkvkvglsdlyngqiletiggkqlrvfvyrtaicienscmvrgsk

[0066] 481qgrngaihifreiiqpaekslhdklrqdkrfsiflslleaadlkdlltqpgdwtlfaptn

[0067] 541dafkgmtseerelligdknalqniilyhltpgvyigkgfepgvtnilkttqgskiylkgv

[0068] 601netllvnelkskesdimttngvihvvdkllypadipvgndqllellnklikyiqikfvrg

[0069] 661stfkeipmtvyrpamtkiqiegdpdfrlikeg...

Embodiment 3

[0084] Give db / db mice a tail vein injection of the Periostin antibody prepared in Example 2 for two weeks, and the injection volume is 5 mg / kg, and give another db / db mouse a tail vein injection of IgG for two weeks, and the injection volume is 5 mg / kg as a control The test results are as follows: the liver / body weight ratio of the Periostin antibody injection mouse group was significantly reduced; the TG content in the liver and serum was also significantly reduced; the serum b-hydroxybutyric acid level was also greatly increased, specifically as follows Figure 8 A- Figure 8 D shows. At the same time, the expression of genes related to fatty acid β-oxidation also increased, such as Figure 9 shown.

[0085] Through the above experiments, it is shown that the Periostin antibody can significantly improve the development of NAFLD and also improve hyperlipidemia, and can be applied to the preparation of drugs for treating NAFLD and hyperlipidemia.

[0086]

[0087]

...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention relates to the field of medicament preparation, and particularly relates to applications of a Periostin gene and a Periostin antibody in preparation of medicaments. The Periostin gene expression is closely relevant to the occurrence and development of NAFLD (Nonalcoholic Fatty Liver Disease) and hyperlipidemia through remarkable expression increase of the Periostin gene in the liver of a high-fat diet-induced obesity mouse, the significant expression rise of Periostin in a patient with fatty liver, and obvious positive correlation between the Periostin and liver TG (Triglyceride) content as well as serum TG content, and the Periostin gene and the Periostin antibody can be used for preparing and screening a NAFLD reagent and a hyperlipidemia reagent. The Periostin antibody can be used for neutralizing Periostin in the obese mouse body, obviously reducing the liver / weight ratio, and the TG content of the liver and serum, therefore, the Periostin antibody achieves the effects of obviously improving the development of the NAFLD and reducing the TG content in serum.

Description

technical field [0001] The invention relates to the field of medicine preparation, in particular to the application of periostin gene and periostin antibody in medicine preparation. Background technique [0002] Nonalcoholic fatty liver disease (NAFLD) has become an important public health problem. In the past ten years, the prevalence of NAFLD in western countries has risen to 20-30%, and the incidence of NAFLD in obese people even exceeds 50%. In recent years, with the changes in people's lifestyle and diet structure, the prevalence of adult NAFLD in some areas of my country has exceeded 15%, and it is gradually becoming younger, seriously endangering people's health. In addition to the health and psychological problems caused by NAFLD itself, a variety of related diseases such as type 2 diabetes, cardiovascular and cerebrovascular diseases, liver fibrosis, liver cirrhosis and even liver cancer, etc., if not diagnosed and treated in time, the disease will be fatal. It se...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Patents(China)
IPC IPC(8): A61K49/00A61K39/395C07K16/18A61P3/06A61P1/16
Inventor 李小英陆炎刘醒熊雪莲
Owner RUIJIN HOSPITAL AFFILIATED TO SHANGHAI JIAO TONG UNIV SCHOOL OF MEDICINE
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap