Antibody to periostin and its application in drug preparation
A periostin and antibody technology, which is applied in the direction of antibodies, drug combinations, preparations for in vivo tests, etc., can solve the problems that the effect has not been reported yet, and achieve the effect of improving the development of NAFLD and reducing the content of TG
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0051] C57BL / 6 mice were divided into two groups, one group was fed with high-fat for 12 weeks, and the other group was fed with low-fat for 12 weeks. By gene expression profiling chip technology, the mice in the high-fat group and low-fat group were compared. Differences in gene expression in mouse liver, from which it was found that in the liver of obese mice induced by high-fat diet, the expression was significantly up-regulated (pfigure 1 As shown; for leptin receptor-deficient db / db obese mice and leptin-deficient ob / ob obese mice, the expression of Periostin in the liver of two groups of obese mice was significantly up-regulated, specifically as figure 2 Shown; in fatty liver patients, the expression of Periostin was significantly increased, and showed a significant positive correlation with liver TG content, see image 3 shown.
[0052] The experiment uses the adenovirus-mediated overexpression system to specifically overexpress Periostin in the liver of C57BL / 6 mice. ...
Embodiment 2
[0056] Periostin antibody production process.
[0057] 1), the amino acid sequence of mouse Periostin protein (as shown in SEQIDNo.1) is:
[0058] 1mvpllplyallllflcdinpanansyydkvlahsrirgrdqgpnvcalqqilgtkkkyfs
[0059] 61scknwyqgaicgkkttvlyeccpgymrmegmkgcpavmpidhvygtlgivgatttqhysd
[0060] 121vsklreeiegkgsytyfapsneawenldsdirrglennvnvellnalhshmvnkrmltkd
[0061] 181lkhgmvipsmynnlglfinhypngvvtvncarvihgnqiatngvvhvidrvltqigtsiq
[0062] 241dfleaeddlssfraaaitsdlleslgrdghftlfaptneafeklprgvlerimgdkvase
[0063] 301almkyhilntlqcseaitggavfetmegntieigcegdsisingikmvnkkdivtkngvi
[0064] 361hlidevlipdsakqvielagkqqttftdlvaqlglasslkpdgeytllapvnnafsddtl
[0065] 421smdqrllklilqnhilkvkvglsdlyngqiletiggkqlrvfvyrtaicienscmvrgsk
[0066] 481qgrngaihifreiiqpaekslhdklrqdkrfsiflslleaadlkdlltqpgdwtlfaptn
[0067] 541dafkgmtseerelligdknalqniilyhltpgvyigkgfepgvtnilkttqgskiylkgv
[0068] 601netllvnelkskesdimttngvihvvdkllypadipvgndqllellnklikyiqikfvrg
[0069] 661stfkeipmtvyrpamtkiqiegdpdfrlikeg...
Embodiment 3
[0084] Give db / db mice a tail vein injection of the Periostin antibody prepared in Example 2 for two weeks, and the injection volume is 5 mg / kg, and give another db / db mouse a tail vein injection of IgG for two weeks, and the injection volume is 5 mg / kg as a control The test results are as follows: the liver / body weight ratio of the Periostin antibody injection mouse group was significantly reduced; the TG content in the liver and serum was also significantly reduced; the serum b-hydroxybutyric acid level was also greatly increased, specifically as follows Figure 8 A- Figure 8 D shows. At the same time, the expression of genes related to fatty acid β-oxidation also increased, such as Figure 9 shown.
[0085] Through the above experiments, it is shown that the Periostin antibody can significantly improve the development of NAFLD and also improve hyperlipidemia, and can be applied to the preparation of drugs for treating NAFLD and hyperlipidemia.
[0086]
[0087]
...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap