Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Soilless bean sprout culture solution

A technology of soilless culture and culture solution, applied in soilless culture, cultivation, food preservation and other directions, can solve the problems of not easy to expand production, long growth cycle, etc., and achieve the effect of healthy sterilization method, less water, and low production cost

Inactive Publication Date: 2017-10-20
磐安县派普特生物科技有限公司
View PDF8 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

This production method uses clear water mixed with garlic juice and pepper water to soak the beans to be cultivated. The sterilization method is healthier, but the growth cycle is long and it is not easy to expand production

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0013] The bean sprouts soilless culture solution has the following components and parts by weight: 0.015 parts of zinc sulfate, 0.04 parts of chitosan oligosaccharide, 0.035 parts of disinfectant, 3.5 parts of natural ore, and 100 parts of water. The natural ore is medical stone, and the ore composition is SiO 2 、Al 2 o 3 , Fe 2 o 3 , FeO, MgO, CaO, K 2 O, Na 2 O, TiO 2 ,P 2 o 5 , MnO, K 2 O, Na 2 O, CaO, MgO, Cu, Mo, etc.; the disinfectant is a mixture of chlorine dioxide and active polypeptide, the mass ratio of which is 1:0.015, and the amino acid sequence of the active polypeptide is TDHAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS. substances, change its osmotic pressure, inhibit its growth and reproduction, and help prevent the phenomenon of root burning and rotten sprouts during the cultivation of bean sprouts, and increase the yield of bean sprouts; Infection of bean sprouts causes rotten ...

Embodiment 2

[0018] The bean sprouts soilless culture solution has the following components and parts by weight: 0.014 parts of zinc sulfate, 0.05 parts of chitosan oligosaccharide, 0.035 parts of disinfectant, 4 parts of natural ore, and 99 parts of water. The natural ore is medical stone, and the ore composition is SiO 2 、Al 2 o 3 , Fe 2 o 3 , FeO, MgO, CaO, K 2 O, Na 2 O, TiO 2 ,P 2 o 5 , MnO, K 2 O, Na 2 O, CaO, MgO, Cu, Mo, etc.; the disinfectant is a mixture of chlorine dioxide and active polypeptide, the mass ratio of which is 1:0.02, and the amino acid sequence of the active polypeptide is TDHAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS, which can destroy harmful microorganisms such as mold cell membranes substances, change its osmotic pressure, inhibit its growth and reproduction, and help prevent the phenomenon of root burning and rotten buds during the cultivation of bean sprouts, and increase the yi...

Embodiment 3

[0023] The bean sprouts soilless culture solution comprises the following components and parts by weight: 0.02 parts of zinc sulfate, 0.05 parts of chitosan oligosaccharide, 0.03 parts of disinfectant, 3 parts of natural ore, and 99 parts of water. The disinfectant is a mixture of chlorine dioxide and active polypeptide, the mass ratio of which is 1:0.013, and the amino acid sequence of the active polypeptide is TDHAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS.

[0024] The preparation method of the bean sprouts soilless culture solution comprises the following steps: crush the natural ore into granules with a particle size of ≤1 mm, then soak the crushed natural ore granules and water for 75 minutes, and filter to obtain the soaking solution; take the formulated amount of zinc sulfate , chitosan oligosaccharide and disinfectant are added into the soaking solution and stirred evenly to obtain the bean sprouts ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a soilless bean sprout culture solution. The soilless bean sprout culture solution is composed of, by weight part, 0.01-0.02 part of zinc sulfate, 0.03-0.05 part of chitosan oligosaccharide, 0.03-0.04 disinfector, 3-4 parts of natural ores and 99-100 parts of water. The soilless bean sprout culture solution has the advantages of accelerating growth of seeds, ensuring tenderness and bending resistance of bean sprout, improving the essence concentration of bean sprout and ensuring bean sprout to be good in taste and free from toxic and hazardous substance. The soilless bean sprout culture solution is rich in mineral nutrients and trace elements, so that produced bean sprout is higher in content of trace elements such as potassium, sodium, magnesium and iron and vitamin C than common bean sprout and further increases nutrients. The soilless bean sprout culture solution is sanitary in sterilization to ensure no odor, no toxicity and no residue of bean sprout and shortens the growth period of bean sprout. Meanwhile, the soilless bean sprout culture solution is simple in raw material acquisition, low in production cost, technically easy to accept and grasp and applicable to scale production.

Description

technical field [0001] The invention relates to the field of bean sprout cultivation, in particular to a soilless bean sprout culture solution. Background technique [0002] Sprouting vegetables (sprouting vegetables), referred to as sprouts, usually refer to sprouts, seedlings or sprouts that are directly edible by using plant seeds (beans, vegetables, grains or tree seeds) to germinate under dark or light conditions. There are more than 30 kinds of young lotus sprouts, such as soybean sprouts, mung bean sprouts, wheat sprouts, radish sprouts, alfalfa sprouts, pea sprouts, perilla sprouts, buckwheat sprouts, sesame sprouts, and Chinese toon sprouts. Sprouts are easy to cultivate and have a short production cycle. Under normal temperature conditions, it generally only takes about 5-12 days from sowing to harvesting. It can be cultivated at home and is also suitable for large-scale industrial production. Sprouts are usually eaten by people with their young and tender organs....

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A01G31/00A23B7/154A23B7/157A01N59/00A01N37/46A01P1/00
CPCA01N37/46A01N59/00A23B7/154A23B7/157A01N2300/00Y02P60/21
Inventor 陈雨诗
Owner 磐安县派普特生物科技有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products