Soilless bean sprout culture solution
A technology of soilless culture and culture solution, applied in soilless culture, cultivation, food preservation and other directions, can solve the problems of not easy to expand production, long growth cycle, etc., and achieve the effect of healthy sterilization method, less water, and low production cost
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0013] The bean sprouts soilless culture solution has the following components and parts by weight: 0.015 parts of zinc sulfate, 0.04 parts of chitosan oligosaccharide, 0.035 parts of disinfectant, 3.5 parts of natural ore, and 100 parts of water. The natural ore is medical stone, and the ore composition is SiO 2 、Al 2 o 3 , Fe 2 o 3 , FeO, MgO, CaO, K 2 O, Na 2 O, TiO 2 ,P 2 o 5 , MnO, K 2 O, Na 2 O, CaO, MgO, Cu, Mo, etc.; the disinfectant is a mixture of chlorine dioxide and active polypeptide, the mass ratio of which is 1:0.015, and the amino acid sequence of the active polypeptide is TDHAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS. substances, change its osmotic pressure, inhibit its growth and reproduction, and help prevent the phenomenon of root burning and rotten sprouts during the cultivation of bean sprouts, and increase the yield of bean sprouts; Infection of bean sprouts causes rotten ...
Embodiment 2
[0018] The bean sprouts soilless culture solution has the following components and parts by weight: 0.014 parts of zinc sulfate, 0.05 parts of chitosan oligosaccharide, 0.035 parts of disinfectant, 4 parts of natural ore, and 99 parts of water. The natural ore is medical stone, and the ore composition is SiO 2 、Al 2 o 3 , Fe 2 o 3 , FeO, MgO, CaO, K 2 O, Na 2 O, TiO 2 ,P 2 o 5 , MnO, K 2 O, Na 2 O, CaO, MgO, Cu, Mo, etc.; the disinfectant is a mixture of chlorine dioxide and active polypeptide, the mass ratio of which is 1:0.02, and the amino acid sequence of the active polypeptide is TDHAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS, which can destroy harmful microorganisms such as mold cell membranes substances, change its osmotic pressure, inhibit its growth and reproduction, and help prevent the phenomenon of root burning and rotten buds during the cultivation of bean sprouts, and increase the yi...
Embodiment 3
[0023] The bean sprouts soilless culture solution comprises the following components and parts by weight: 0.02 parts of zinc sulfate, 0.05 parts of chitosan oligosaccharide, 0.03 parts of disinfectant, 3 parts of natural ore, and 99 parts of water. The disinfectant is a mixture of chlorine dioxide and active polypeptide, the mass ratio of which is 1:0.013, and the amino acid sequence of the active polypeptide is TDHAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS.
[0024] The preparation method of the bean sprouts soilless culture solution comprises the following steps: crush the natural ore into granules with a particle size of ≤1 mm, then soak the crushed natural ore granules and water for 75 minutes, and filter to obtain the soaking solution; take the formulated amount of zinc sulfate , chitosan oligosaccharide and disinfectant are added into the soaking solution and stirred evenly to obtain the bean sprouts ...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More