Preparation method of chlorella polysaccharide
A technology of chlorella and chlorella powder, which is applied in anti-tumor drugs, food science, drug combination, etc., to achieve the effects of simple extraction process, excellent body immunity, and low production cost
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0015] A preparation method of chlorella polysaccharide is:
[0016] 1) Take chlorella powder to make algae liquid, the solid-liquid ratio of chlorella powder to water is 1:48, add active polypeptide, the amount added is 0.04% of the weight of chlorella powder, the amino acid sequence of active polypeptide is QSGFCTSYYCSKFCTAGSLGNLTPGKICLHCSS , using sodium phosphate buffer as the extractant, the pH of the sodium phosphate buffer is 7.2, at -20°C and 28°C, repeated freezing and thawing 5 times, each 4h, ultrasonic treatment, ultrasonic power 500w, time is 8min, centrifuge at 7000r / min for 6min, take the supernatant to obtain the crude protein extract;
[0017] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 3 / 10 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 85% ethanol solution to the concentrate, stir for 15min, and centrifuge at 8000r / min 7min, get crude polysaccharide;
[0018] 3) To redissolve, add 20% tr...
Embodiment 2
[0022] A preparation method of chlorella polysaccharide is:
[0023] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is preferably 1:45, add active polypeptide, the amount added is 0.05% of the weight of chlorella powder, the amino acid sequence of active polypeptide is QSGFCTSYYCSKFCTAGSLGNLTPGKICLHCSS, choose sodium phosphate buffer as the extractant, the pH value of sodium phosphate buffer is preferably 7, freeze and thaw 4 times at -20°C and 28°C, each time 3.8h, ultrasonic treatment, the ultrasonic power is preferably 600w, the time is 8min, centrifuged at 8000r / min for 6min, and the supernatant is taken to obtain the crude protein extract;
[0024] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 1 / 5 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 92% ethanol solution to the concentrate, stir for 14min, and centrifuge at 10000r / min 8min, get crude polysa...
Embodiment 3
[0029] A preparation method of chlorella polysaccharide is:
[0030] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is 1:48, add active peptides, the amount added is 0.03% of the weight of chlorella powder, the amino acid sequence of active peptides is QSGFCTSYYCSKFCTAGSLGNLTPGKICLHCSS , using sodium phosphate buffer as the extractant, the pH value of the sodium phosphate buffer is 7, at -20°C and 28°C, repeated freezing and thawing 5 times, each time 4h, ultrasonic treatment, ultrasonic power 450w, time is 5min, centrifuge at 6000r / min for 10min, take the supernatant to obtain crude protein extract;
[0031] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 1 / 10 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 88% ethanol solution to the concentrate, stir for 14min, and centrifuge at 8000r / min 8min, get crude polysaccharide;
[0032] 3) To redissolve, add 21%...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More