Unlock instant, AI-driven research and patent intelligence for your innovation.

Preparation method of chlorella polysaccharide

A technology of chlorella and chlorella powder, which is applied in anti-tumor drugs, food science, drug combination, etc., to achieve the effects of simple extraction process, excellent body immunity, and low production cost

Inactive Publication Date: 2018-01-12
兰溪市酉泽饲料技术服务有限公司
View PDF2 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The raw material source of the invention is rich and cheap, and can be derived from the residue after oil production of chlorella, and the method is simple in process and low in production cost, and is a method for effectively improving the high added value and comprehensive utilization rate of chlorella, but the method There is still room for improvement in the yield of chlorella polysaccharides

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0015] A preparation method of chlorella polysaccharide is:

[0016] 1) Take chlorella powder to make algae liquid, the solid-liquid ratio of chlorella powder to water is 1:48, add active polypeptide, the amount added is 0.04% of the weight of chlorella powder, the amino acid sequence of active polypeptide is QSGFCTSYYCSKFCTAGSLGNLTPGKICLHCSS , using sodium phosphate buffer as the extractant, the pH of the sodium phosphate buffer is 7.2, at -20°C and 28°C, repeated freezing and thawing 5 times, each 4h, ultrasonic treatment, ultrasonic power 500w, time is 8min, centrifuge at 7000r / min for 6min, take the supernatant to obtain the crude protein extract;

[0017] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 3 / 10 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 85% ethanol solution to the concentrate, stir for 15min, and centrifuge at 8000r / min 7min, get crude polysaccharide;

[0018] 3) To redissolve, add 20% tr...

Embodiment 2

[0022] A preparation method of chlorella polysaccharide is:

[0023] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is preferably 1:45, add active polypeptide, the amount added is 0.05% of the weight of chlorella powder, the amino acid sequence of active polypeptide is QSGFCTSYYCSKFCTAGSLGNLTPGKICLHCSS, choose sodium phosphate buffer as the extractant, the pH value of sodium phosphate buffer is preferably 7, freeze and thaw 4 times at -20°C and 28°C, each time 3.8h, ultrasonic treatment, the ultrasonic power is preferably 600w, the time is 8min, centrifuged at 8000r / min for 6min, and the supernatant is taken to obtain the crude protein extract;

[0024] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 1 / 5 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 92% ethanol solution to the concentrate, stir for 14min, and centrifuge at 10000r / min 8min, get crude polysa...

Embodiment 3

[0029] A preparation method of chlorella polysaccharide is:

[0030] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is 1:48, add active peptides, the amount added is 0.03% of the weight of chlorella powder, the amino acid sequence of active peptides is QSGFCTSYYCSKFCTAGSLGNLTPGKICLHCSS , using sodium phosphate buffer as the extractant, the pH value of the sodium phosphate buffer is 7, at -20°C and 28°C, repeated freezing and thawing 5 times, each time 4h, ultrasonic treatment, ultrasonic power 450w, time is 5min, centrifuge at 6000r / min for 10min, take the supernatant to obtain crude protein extract;

[0031] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 1 / 10 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 88% ethanol solution to the concentrate, stir for 14min, and centrifuge at 8000r / min 8min, get crude polysaccharide;

[0032] 3) To redissolve, add 21%...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a preparation method of chlorella polysaccharide, and belongs to the technical field of polysaccharide extraction. The extraction of the chlorella polysaccharide comprises the steps of cell wall breaking, concentration and alcohol precipitation, protein removal, and freeze drying, wherein the cell wall breaking are as follows: preparing an alga solution by chlorella powder,adding an active polypeptide, selecting a sodium phosphate buffer solution as an extracting agent, repeatedly performing freezing and thawing, ultrasonic treatment and centrifuging, and taking supernate to obtain a crude protein extracting solution. The chlorella polysaccharide extracted by the method provided by the invention has excellent effects of promoting organism immunity and resisting tumors, and can be used in health care products. The extraction process of the chlorella polysaccharide is simple, the operability is high, and the production cost is low.

Description

technical field [0001] The invention belongs to the technical field of polysaccharide extraction, and in particular relates to a preparation method of chlorella polysaccharide. Background technique [0002] Chlorella pyrenoidosa FACHBS is a kind of general unicellular algae. Chlorella has the advantages of wide ecological distribution, rapid growth and reproduction, and easy cultivation. It is the only organism among animals and plants on the earth that can grow 4 times in 20 hours, and has high application value. At present, chlorella has been widely used in animal feed, food additives, pharmaceutical preparations, beauty products, etc. Chlorella and its hot water extracts have the effects of promoting immunity and anti-tumor. A large number of experiments have proved that chlorella Among the active components of Chlorella, polysaccharides have the functions of promoting immunity and anti-tumor. The extraction of polysaccharides from Chlorella is generally carried out by h...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C08B37/00A23L33/125A61P37/02A61P35/00
Inventor 孙琦
Owner 兰溪市酉泽饲料技术服务有限公司