Penaeus monodonantibacterial peptideALFpm10 and preparation method thereof
A technology of penaeus monodon and antibacterial peptides, applied in the field of crustacean genetic engineering, can solve the problem of poor killing effect and other problems
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0050] In order to make the object, technical solution and advantages of the present invention more clear, the present invention will be further described in detail below in conjunction with the examples. It should be understood that the specific embodiments described here are only used to explain the present invention, not to limit the present invention.
[0051] The antimicrobial peptide ALFpm10 cloned from the hemocytes of Penaeus monodon provided by the examples of the present invention contains 132 amino acids in total, with a molecular weight of about 15.3 KDa, and its N-terminal 27 amino acid sequence is a "signal peptide".
[0052] Among them, the antimicrobial peptide ALFpm10 contains a total of 132 amino acids:
[0053] SEQ ID NO: 1:
[0054] MTNQRTSWAHWLALFLLTATSVKLLSAQEMEEQENHVSDIVSKIYNFLRNGEIELLGHYCSYSTRPYFLRWQLKFKTKIWCPGWTLVYGSAKGNSSVSSSLQDAIVNFVQKAYQEDVISEEDAKPWLQGRK
[0055] Signal peptide SEQ ID NO: 2:
[0056] MTNQRTSWAHWLALFLLTATSVKLLSA.
[0057] The cDN...
PUM
Property | Measurement | Unit |
---|---|---|
molecular weight | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com