Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Penaeus monodonantibacterial peptideALFpm10 and preparation method thereof

A technology of penaeus monodon and antibacterial peptides, applied in the field of crustacean genetic engineering, can solve the problem of poor killing effect and other problems

Active Publication Date: 2018-12-18
SHENZHEN UNIV
View PDF5 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0010] Therefore, the antimicrobial peptides derived from prawns have the following advantages: ①Good biological safety, the antimicrobial peptides derived from prawns themselves will not cause harm to prawn farming and the water environment; ; ③ It can inhibit and kill bacteria from the ocean. Many marine bacteria can tolerate stress such as high salt, resulting in poor antimicrobial peptides from other sources.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Penaeus monodonantibacterial peptideALFpm10 and preparation method thereof
  • Penaeus monodonantibacterial peptideALFpm10 and preparation method thereof
  • Penaeus monodonantibacterial peptideALFpm10 and preparation method thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0050] In order to make the object, technical solution and advantages of the present invention more clear, the present invention will be further described in detail below in conjunction with the examples. It should be understood that the specific embodiments described here are only used to explain the present invention, not to limit the present invention.

[0051] The antimicrobial peptide ALFpm10 cloned from the hemocytes of Penaeus monodon provided by the examples of the present invention contains 132 amino acids in total, with a molecular weight of about 15.3 KDa, and its N-terminal 27 amino acid sequence is a "signal peptide".

[0052] Among them, the antimicrobial peptide ALFpm10 contains a total of 132 amino acids:

[0053] SEQ ID NO: 1:

[0054] MTNQRTSWAHWLALFLLTATSVKLLSAQEMEEQENHVSDIVSKIYNFLRNGEIELLGHYCSYSTRPYFLRWQLKFKTKIWCPGWTLVYGSAKGNSSVSSSLQDAIVNFVQKAYQEDVISEEDAKPWLQGRK

[0055] Signal peptide SEQ ID NO: 2:

[0056] MTNQRTSWAHWLALFLLTATSVKLLSA.

[0057] The cDN...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
molecular weightaaaaaaaaaa
Login to View More

Abstract

The invention belongs to the technical field of crustacean genetic engineering, and discloses a Ppenaeus monodonantibacterial peptide ALFpm10 and a preparation method thereof. The Ppenaeus monodonantibacterial peptide ALFpm10 is prepared from 132 amino acids, the molecular weight is 15.3 kDa, and the signal peptide is prepared from 27 amino acids; the full-length cDNA of the ALFpm10 antibacterialpeptide is prepared from 517 bases, and obtained from RT-PCR cloning in the total RNA of a Penaeus monodon blood cell; the ALFpm10 antibacterial peptide can be obtained by fusion expression with SUMOprotein through a prokaryotic expression system, which is a solid phase chemosynthetic method. The ALFpm10 antibacterial peptide disclosed by the invention has antibacterial and bactericidal effects against Staphylococcus aureus, coastal Exiguobacterium,algae-occupying Bacillusand the like, and has the characteristics of high bactericidal efficiency, small usage amount, long lasting, and capable of suppressing seawater bacteria, and shows a broad application prospect in the aquaculture industry.

Description

technical field [0001] The invention belongs to the technical field of crustacean genetic engineering, and in particular relates to an antibacterial peptide ALFpm10 of Penaeus monodon and a preparation method thereof. Background technique [0002] At present, the existing technologies commonly used in the industry are as follows: [0003] In recent years, the aquaculture and fishing output in my country's fishery has jumped to the forefront of the world, and the fishery economy has developed very rapidly, and aquaculture accounts for 70% of the global aquaculture. However, with the development of intensive and semi-intensive aquaculture models in China and the increasing degree of intensification, eutrophic factors such as residual bait, feces, and aquatic animal and plant carcasses coexist in one water body, coupled with water pollution and The reduction of self-purification and regulation ability of ponds has led to severe excess of chemical oxygen demand, biological oxyg...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/435C07K1/22C12N15/12C12N15/70A61P31/04
CPCA61P31/04C07K14/43504
Inventor 王潮岗周亮李国强胡章立
Owner SHENZHEN UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products