Bovine echinococcosis granulosa time-resolved fluorescence immunochromatographic assay test strip and preparation method thereof
A technology for time-resolved fluorescence and echinococcosis granulosus, applied in botany equipment and methods, biochemical equipment and methods, analytical materials, etc., can solve the problems of inconspicuous antibody response, few animals, and low accuracy , to achieve good sensitivity and accuracy, rapid diagnostic method, and good specificity
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0041] Preparation of recombinant multi-epitope antigen (named Eg-H1)
[0042] The selected peptides are as follows:
[0043] B1 (antigen B subunit 1): DDGLTSTSRSVMKMFGEVKYFFERDPLGQK;
[0044] B2 (antigenB subunit 2): KDEPKAHMGQVVKKRWGELRDFFRND;
[0045] B3 (antigenB subunit4): LGEIRDFFRSDPLGQKLVALGRRDLTAI;
[0046] B4 (EG95): KGMGVETRTTETPLRKHFNLTPVGSQGI;
[0047] B5 (antigenprotein): TGNCDQGKAQSANVTG;
[0048] B6(Ag5):ECSPHTCLEHRYRRCVD;
[0049] B7 (EPC1): GKISCAELKSALQSCSA.
[0050] In a series manner, the above-mentioned peptides were linked together using a linker GGGGSGGGGSGGGGS. As a preference, the above-mentioned peptides are linked together in sequence, and the amino acid sequence thereof is:
[0051] MDDGLTSTSRSVMKMFGEVKYFFERDPLGQKGGGGSGGGGSGGGGSKDEPKAHMGQVVKKRWGELRDFFRNDGGGGSGGGGSGGGGSLGEIRDFFRSDPLGQKLVALGRDLTAIGGGGSGGGGSGGGGSKGMGVETRTTETPLRKHFNLTPVGSQGIGGGGSGGGGSGGGGSTGNCDQGKAQSANVTGGGGGSGGGGSGGGGSECSPHTCLEHRYRRCVDGGGGSGGGGSGGGGSGKISCAELKSALQSCSA(SEQ ID NO....
Embodiment 2
[0105] Such as figure 1 As shown, the bovine echinococcosis time-resolved fluorescent immunochromatographic detection test strip of this embodiment includes a PVC base plate 1, and a sample pad 2, a binding pad 3, and a nitrocellulose base plate sequentially arranged on the PVC base plate. Membrane 4 and absorbent pad 5, binding pad 3 is coated with goat anti-bovine IgG antibody labeled with time-resolved fluorescent microspheres, nitrocellulose membrane 4 is provided with separated detection line 6 and quality control line 7, detection line 6 It is coated with recombinant multi-epitope antigen Eg-H1, and the quality control line 7 is coated with rabbit anti-goat IgG secondary antibody.
[0106] Its preparation method comprises the following steps:
[0107] Preparation of S1 binding pad: label time-resolved fluorescent microspheres with goat anti-bovine IgG antibody at a labeling amount of 50 μg / mL, and then add fluorescent working solution (0.01M phosphate buffer) at a volum...
Embodiment 3
[0114] In order to improve the accuracy of bovine echinococcosis time-resolved fluorescent immunochromatographic test strip detection, the following conditions were explored:
[0115] Preconditions for optimizing time-resolved fluorescent microsphere immunochromatographic test strips: other conditions remain unchanged, and only one of the variables is changed each time. The reaction conditions were as follows: the positive sample and the negative sample (both collected in the Zoige county slaughterhouse) were added with a sample volume of 75 μL (the volume ratio of serum to sample buffer was 1:2), and the reaction time was 15 minutes. The coating parameter is 0.75 μL / cm and the spraying parameter is used to coat the antigen or antibody on the nitrocellulose membrane to form the detection line (T) and the quality control line (C).
[0116] Determination of C-line coating amount: Spray 1mg / mL Eg-H1 on the T-line with a three-dimensional gold-spraying device, and prepare two grou...
PUM

Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com