Type II grass carp reovirus VP4-NS38 fusion protein gene, expression vector, strain and application thereof
A technology of fusion protein and grass carp hemorrhagic disease, applied in the direction of virus/phage, virus, virus peptide, etc., can solve the problems of limited application effect, low immune protection rate, and low immune protection rate of bacillus oral vaccine
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0052] Embodiment 1 Design the gene sequence of fusion protein
[0053] In this example, a fusion protein was prepared, which contained genotype II grass carp reovirus VP4 protein and NS38 protein. The nucleotide sequence encoding the gene type II grass carp reovirus VP4 protein corresponds to that shown in SEQ ID NO.1, specifically:
[0054] TTTGGCAATATTCGCAACATTACCGACTTCTCAATGTCTGCAATTTGGGAACCAGAGACAGT CAGCGCGGCAGGCAATTACTATCTATGGCCGACCGTAATCGGTGATGCATCAATGACATCAGATT GGGGGACAATTAGCACATCCCTAGCTAATGGCAGACTCCGTGTCGCACCTCTGGACCTGACTCA TGCACTCCACAAAGGCAATGTCGTGGAGCCGATCGTACCATCTGATGTGCTAGGTAATGCCTCA CCAGAGGAAATGCGTTCCGCGTTGCCAGCAGATGTGCTGACAGCTTTCAAAGCCAAGCTCACA ACAGTGGCTTCCGTAGTCGGCCGTGCCTTAAATCCCAACGACAGTGCGCATGCACCATCATCCG GCACCGTCCTCGGCCCGCTTGCAATCGAAAACAAGGCCCAATCAAAACCTAAACCCGTATCAG ATCTGTGGATAGCCGCTYGTCGTGGTGTGAATCTATTCGTAGCCTCTCCAAGCGCGAGTCTGCA AACAGGTGTGCCGGTCATGGGGGACAGCAGCGTGTTGACAAGCTTGACGGGTGGTGCAACTA CCGCGTTGAATACTGGTGACATGGGTACCCCAAGCTTGGAGGCCACAGCGAAACGGGCAGCTA GAG...
Embodiment 2
[0063] Example 2 Construction of Expression Recombinant Vector PEB03-CotC-GCRV VP4-NS38
[0064] This example prepares an expression vector. Connect the GCRV VP4-NS38 gene fragment to the Bacillus subtilis plasmid vector PEB03 to obtain the recombinant vector PEB03-GCRV VP4-NS38, extract the Bacillus subtilis WB600 genomic DNA, and extract the CotC target fragment from the Bacillus subtilis genomic DNA with primers P5 and P6 After PCR amplification, restriction enzyme sites: Sal I and Bam H I were introduced at the same time, and the amplified fragment was connected to the recombinant vector PEB03-GCRV VP4-NS38 to construct PEB03-CotC that fused and expressed CotC protein and GCRV VP4-NS38 protein - GCRV VP4-NS38 recombinant vector.
[0065] The amino acid sequence of the GCRV VP4 protein is shown in SEQ ID NO.5:
[0066] FGNIRNITDFSMSAIWEPETVSAAGNYYLWPTVIGDASMTSDWGTISTSLANGRLRVAPLDLTH ALHKGNVVEPIVPSDVLGNASPEEMRSALPADVLTAFKAKLTTVASVVGRALNPNDSAHAPSSGTVLGPLAIENKAQSKPKPVSDLWIAA...
Embodiment 3
[0074] Embodiment 3 Transformation of recombinant expression vector PEB03-CotC-VP44-NS38
[0075] In this example, the constructed recombinant plasmid PEB03-CotC-VP44-NS38 was electrotransformed into Bacillus subtilis WB600, and the specific steps were as follows:
[0076] 1) Inoculate WB600 in 3ml LB medium, culture overnight at 37°C, 250rpm;
[0077] 2) Transfer 2.6ml of bacterial liquid into 40ml of electroporation A medium, shake at 37°C and 250rpm until the OD value is 0.8-0.9;
[0078] 3) Bacterial solution in an ice-water bath for 10 minutes; centrifuge at 5000g at 4°C for 5 minutes;
[0079] 4) Use 50ml of pre-cooled electroporation B medium to blow the suspended bacteria; centrifuge at 5000g, 4°C for 5min; repeat this step 4 times;
[0080] 5) Suspend the bacteria in 1ml electroporation B medium, aliquot into 10 tubes, and aliquot 100μl in each EP tube;
[0081] 6) Add 5 μl (about 1 μg) of recombinant plasmid PEB03-CotC-VP4 to 100 μl WB600 competent cells, and let ...
PUM
| Property | Measurement | Unit |
|---|---|---|
| diameter | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More 


