Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Method for improving thermal stability of enzyme

A thermostable, recombinant enzyme technology, applied in the direction of enzyme stabilization, microorganism-based methods, biochemical equipment and methods, etc. The effect of easy promotion and simple process

Active Publication Date: 2012-09-12
JIANGNAN UNIV
View PDF2 Cites 9 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, these methods are not suitable for the thermostability modification of all enzyme molecules

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Method for improving thermal stability of enzyme
  • Method for improving thermal stability of enzyme
  • Method for improving thermal stability of enzyme

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0023] Example 1: Amino acid sequence of amphipathic short peptide and cloned into plasmid pET-22b(+)

[0024] 1 AEAEAKAKAEAEAKAK

[0025] 2. VNYGNGVSCSKTKCSVNWGQAFQERYTAGTNSFVSGVSGVASGAGSIGIGRR

[0026] 3. DWLKAFYDKVAEKLKEAFKVEPLRADWLKAFYDKVAEKLKEAF

[0027] 4. DWLKAFYDKVAEKLKEAFGLLPVLEDWLKAFYDKVAEKLKEAF

[0028] 5. DWLKAFYDKVAEKLKEAFKVQPYLDDWLKAFYDKVAEKLKEAF

[0029] 6. DWLKAFYDKVAEKLKEAFNGGARLADWLKAFYDKVAEKLKEAF

[0030] According to the above amino acid sequence, the DNA sequence was chemically synthesized, and cloned into the plasmid pET-22b(+) until the plasmid pET-22b(+) / AP

Embodiment 2

[0031] Embodiment 2: Construction of recombinant plasmid pET-22b(+) / AP-enzyme

[0032] The target enzyme gene was cloned into the Nco I and Hind III sites of the expression vector pET-22b(+) / AP. The ligation product was transformed into competent Escherichia coli JM109 for transformation. The conversion method is as follows:

[0033] (1) Under sterile conditions, take 200 μL of competent cells and place them in a sterile microcentrifuge tube;

[0034] (2) Add 1-2 μL of recombinant plasmid to each tube, rotate gently to mix the contents, and place on ice for 30 minutes;

[0035] (3) Heat shock at 42°C for 90s (accurate), do not shake the centrifuge tube;

[0036] (4) Quickly transfer the centrifuge tube to an ice bath to cool the cells for 1-2 minutes;

[0037] (5) Add 800 μL of ordinary LB culture medium without antibiotics to each tube;

[0038] (6) Use a sterile spreader to spread 200 μL of the bacterial solution on an agar plate containing ampicillin, and place it flat...

Embodiment 3

[0040] Example 3: Construction of recombinant enzyme expression strains fused with parental short peptides

[0041] Competent Escherichia coli BL21 (DE3) was transformed. The conversion method is as follows:

[0042] (1) Under sterile conditions, take 200 μL of competent cells and place them in a sterile microcentrifuge tube;

[0043] (2) Add 1-2 μL of recombinant plasmid to each tube, rotate gently to mix the contents, and place on ice for 30 minutes;

[0044] (3) Heat shock at 42°C for 90s (accurate), do not shake the centrifuge tube;

[0045] (4) Quickly transfer the centrifuge tube to an ice bath to cool the cells for 1-2 minutes;

[0046] (5) Add 800 μL of ordinary LB culture medium without antibiotics to each tube;

[0047] (6) Use a sterile spreader to spread 200 μL of the bacterial solution on an agar plate containing ampicillin, and place it flat at 37°C for 20 minutes until the liquid is absorbed, then culture it upside down overnight, and observe.

[0048] Sele...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a method for improving the thermal stability of enzyme. The method is used for obtaining the recombinant enzyme with the improved thermal stability through fusion expression of parents small peptide and the recombinant enzyme, wherein the sequence of the optimized parents small peptide is DWLKAFYDKVAEKLKEAFKVQPYLDDWLKAFYDKVAEKLKEAF. The method has the advantages of being remarkable in effect, simple in process and convenient to promote. The method serves as a new method and idea for quickly improving the thermal stability of the industrial enzyme.

Description

technical field [0001] The invention relates to a method for improving the thermal stability of an enzyme, in particular to a method for improving the thermal stability of a recombined enzyme by using the fusion expression of a parental short peptide. Background technique [0002] Amphiphilic short peptides are small molecular peptides with hydrophilic and lipophilic abilities, which widely exist in the structures of membrane proteins and enzymes related to fat metabolism. The characteristics of its parents can help enzyme molecules combine with hydrophobic substrates and realize the positioning of enzyme molecules. [0003] Bioactive enzymes are widely used in industrial production, and improving the thermostability of enzymes is one of the research focuses of industrial enzymes. At present, the methods for improving the thermostability of enzymes mainly include: 1. Directed evolution: screening thermostable mutant strains through techniques such as site-directed mutation,...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C12N15/70C12N9/00C12N9/02C12N9/26C12N9/10C12R1/19
CPCC12N9/96C12N9/0069C12N9/1044C12N9/2411
Inventor 陈坚堵国成陆信曜刘松张娟
Owner JIANGNAN UNIV
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com