Method for preparing ELISA (enzyme-linked immuno sorbent assay) enzyme-labelled antigen through utilizing avidin binding peptide and avidin combining principle
An enzyme-labeled antigen and avidin technology, applied in the fields of immunology and biology, can solve the problems of losing the ability of antibody binding, uncertain structure and function, affecting antibody binding, etc., and achieves retention of reactivity, good reactivity, detection Sensitive effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0022] This example uses the method of the present invention to prepare the enzyme-labeled antigen for detecting porcine circovirus type 2 antibodies, establishes a double-antigen sandwich ELISA method, and compares it with the double-antigen sandwich ELISA established by the enzyme-labeled antigen prepared by the traditional chemical coupling method, The reliability and advantages of this method are illustrated by the detection effect.
[0023] 1) Preparation of enzyme-labeled antigen for detection of circovirus 2 antibody by the method of the present invention
[0024] a. Selection of avidin binding peptide and fusion with antigen molecule Cap⊿41 protein
[0025] The two SBPs whose sequences were selected as DEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP and YNCHPMNNLCKE were fused with the antigen molecule of porcine type 2 circovirus——Cap⊿41 protein (without signal peptide) to obtain two SBP-Cap⊿41 fusion antigens, respectively ACap ⊿41 and BCap ⊿41. The specific process is as fo...
Embodiment 2
[0036] This example is to use the method of the present invention to prepare an enzyme-labeled antigen for detecting the gB protein antibody of pseudorabies virus (the effect of the enzyme-labeled antigen prepared by traditional chemical coupling method is poor, and it cannot be used for the establishment of ELISA method), and establish a double-labeled antigen for detecting the antibody. Antigen sandwich ELISA method, and compared with the commercial kit for detecting the antibody to determine the effect of the enzyme-labeled antigen prepared by this method.
[0037] 1) Using the method of the present invention to prepare an enzyme-labeled antigen for detecting pseudorabies virus gB protein antibody
[0038] a. Selection of avidin-binding peptides and fusion with antigen molecules
[0039] The fusion expression of SBP whose sequence is SNWSHPQFEK and the antigen molecule of pseudorabies virus—gB4 protein (820-917 amino acids of gB) was performed to obtain SBP-gB4 fusion antig...
Embodiment 3
[0050] This example is to use the method of the present invention to prepare an enzyme-labeled antigen for detecting the gE protein antibody of pseudorabies virus (the effect of the enzyme-labeled antigen prepared by the traditional chemical coupling method is poor, and cannot be used for the establishment of the ELISA method), and to establish a double-labeled antigen for the detection of the antibody. Antigen sandwich ELISA method, and compared with the commercial kit for detecting the antibody to determine the establishment effect of the enzyme-labeled antigen prepared by this method.
[0051] 1) Using the method of the present invention to prepare an enzyme-labeled antigen for detecting pseudorabies virus gE protein antibody
[0052] a. Selection of avidin binding peptide and fusion with antigen molecule gE protein
[0053] The SBP whose sequence is selected as DVEAWLGAR is fused with the antigen molecule of pseudorabies virus—gEa protein (amino acids 22-336 of gE protein)...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


