Application of PreS1 in preparation of hepatitis B vaccine and treatment of chronic hepatitis B
A technology for chronic hepatitis B and hepatitis B virus, applied in the field of biomedicine, can solve the problem that HBp vaccine has no good therapeutic effect
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0036] Example 1: Expression and purification of the vaccine
[0037] Using AAV-HBV1.3 (purchased from Beijing Wujiahe Institute of Molecular Medicine Co., Ltd.) infected mouse liver cDNA (obtained by extracting tolerant mouse liver tissue total RNA and reverse transcription) as a template, design specific primers, The HBV PRES1 (ay subtype) DNA fragment was amplified by PCR reaction, and its nucleotide sequence is:
[0038] ATGGGGCAGAATCTTTCCACCAGCAATCCTCTGGGATTCTTTCCCGACCACCAGTTGGATCCAGCCTTCAGAGCAAACACAGCAAATCCAGATTGGGACTTCAATCCCAACAAGGACACCTGGCCAGACGCCAACAAGGTAGGAGCTGGAGCATTCGGGCTGGGTTTCACCCCACCGCACGGAGGCCTTTTGGGGTGGAGCCCTCAGGCTCAGGGCATACTACAAACTTTGCCAGCAAATCCGCCTCCTGCCTCCACCAATCGCCAGACAGGAAGGCAGCCTACCCCGCTGTCTCCACCTTTGAGAAACACTCATCCTCAGGC C (SEQ ID NO: 1)
[0039] Its amino acid sequence is:
[0040] MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPLSPPLRNTHPQA (SEQ ID NO: 2)
[0041] In addition, the DNA sequence of HBV PRES1 (ad subt...
Embodiment 2
[0050] Example 2: The preS1 antigen was used as a vaccine to test its effect of inducing an immune response in the body.
[0051] Use 10μg of the preS1 protein obtained in Example 1 (alone or in combination with the following adjuvants: aluminum adjuvant (purchased from InvivoGen, 1:1-1:9 mix), 10μg TLR-4 ligand MPLA adjuvant (purchased From InvivoGen), 30μgTLR-9 ligand CpG adjuvant (synthesized by Invitrogen) or Freund’s adjuvant (IFA) (purchased from Sigma) subcutaneously immunized C57BL / 6 mice (6-8 weeks, male, purchased from Beijing Weitong Lihua Laboratory Animal Technology Co., Ltd.). The immunization process is as follows figure 2 Shown in A. After immunization, the anti-preS1 antibody response in the serum was detected by ELISA ( figure 2 B); Detection of preS1-specific T cell immune response in the spleen by ELISPOT ( figure 2 C). The experimental results show that preS1 protein combined with adjuvant can induce strong antibody response and specific T cell immune res...
Embodiment 3
[0052] Example 3: Through HBV in vivo infection experiment, the ability of preS1 antigen vaccine to prevent HBV infection was verified.
[0053] By the immunization method in Example 2, 10 μg of the preS1 protein purified in Example 1 was combined with Freund’s adjuvant to subcutaneously immunize C57BL / 6 mice (6-8 weeks, male, purchased from Beijing Weitong Lihua Laboratory Animal Technology Co., Ltd. the company). The immunization process is like image 3 As shown in A, two subcutaneous immunizations were performed at an interval of 14 days. High titer of preS1 specific antibody anti-preS1 ( image 3 B). Then infect 1x10 through the tail vein 10 vg (viral genome) AAV-HBV1.3 (purchased from Beijing Wujiahe Institute of Molecular Medicine Co., Ltd.), blood is collected every week after infection to detect HBV-related antigens in serum, including HBsAg antigen, preS1 antigen and HBV-DNA changes .
[0054] The results show that compared with the group without protein immunization, ...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap