Flow detection reagent for human anti-Mullerian hormone, preparation method of flow detection reagent and application
An anti-Müllerian hormone and flow detection technology is applied in the field of flow detection reagents for human anti-Müllerian hormone and its preparation, which can solve the problem of large fluctuations in laboratory detection values and no unified AMH detection standard calibration measurement. questions of value
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
specific Embodiment 2
[0047] The preparation method of the flow detection reagent of human anti-Müllerian hormone, the specific steps are as follows:
[0048] (1) Preparation of AMH monoclonal antibody
[0049] First, obtain the complete coding sequence of AMH protein and the amino acid sequence of the translated mature corresponding protein from the Uniprot website, and use protein-related software to analyze the stability of the amino acid sequence, epitope, and the structure and sequence of AMH under physiological conditions; select A mature AMH protein sequence (the mature fragment is relatively stable and will not be degraded) (the amino acid sequence of the mature AMH protein fragment is as follows: SAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARGAALARPPCCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR) as the antigen for preparing the anti-Müllerian hormone antibody library, and the base sequence of the antigen was cloned On the prokaryotic expression vector pET-41a, the E.coli prokary...
specific Embodiment 3
[0065] For the application of the above-mentioned flow detection reagent for human anti-Mullerian hormone, the specific steps of using the flow detection reagent to detect the content of human anti-Müllerian hormone are as follows: add the human serum or blood of the sample to be tested to the antibody Ab1- Add a certain volume of antibody Ab2-fluorescent molecular marker solution to the microsphere conjugate solution, and incubate at 37 degrees for 30 minutes. INHB in the sample combines with Ab1 antibody microsphere conjugate and Ab2 antibody fluorescent molecular marker to form a microsphere Ball-Ab1-AMH-Ab2-fluorescent molecule complex, the fluorescence emitted by the fluorescent molecule can be detected by flow cytometry, and the content of human anti-Müllerian hormone in the sample is calculated according to the relationship between the fluorescence intensity and the concentration of AMH , wherein the molar ratio of antibody Ab1-microsphere conjugate to antibody Ab2-fluor...
PUM
| Property | Measurement | Unit |
|---|---|---|
| Diameter | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com


