Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Application of anti-coagulation codium fragile polysaccharide

A polysaccharide and anticoagulant technology of Pinus spinosa, applied in the application field of polysaccharides, can solve the problems of poor absorption effect, small application range, and reduced utilization rate of polysaccharides, so as to enhance immunity of the body, have good anticoagulant effect, Excellent anticoagulant effect

Inactive Publication Date: 2018-01-09
浦江县昂宝生物技术有限公司
View PDF0 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] Most of the pine algae polysaccharides extracted by the prior art are used in medicines, and the scope of application is small, and a small part is used in beverages and foods, but its absorption effect is not very good, which reduces the utilization rate of polysaccharides

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0016] An anticoagulant use of spinosa polysaccharide, which is used as an additive in health products with anticoagulant function, and spinosa polysaccharide has excellent anticoagulant, antithrombotic, and enhanced immunity of the body , used as an additive in health care products is beneficial to improve the use effect and economic value of health care products.

[0017] The preparation steps of the spinosa polysaccharide include: cell wall crushing; polysaccharide crude extraction; polysaccharide extraction and separation and purification, the specific steps are as follows:

[0018] 1) Cell wall fragmentation: take 14 parts of pine algae powder and soak them in absolute ethanol to degrease, extract the solid residue with water, the ratio of solid to liquid is 1:14m / V, stir for 8 minutes, seal and let stand for 4 hours, add 0.25% activity of pine algae powder by weight Polypeptide, the amino acid sequence of the active polypeptide is: HSHACSYYCSNFCHGSCTRHSYLCHRVLHPGKNCSR, s...

Embodiment 2

[0023] An anticoagulant use of spinosa polysaccharide, which is used as an additive in health products with anticoagulant function, and spinosa polysaccharide has excellent anticoagulant, antithrombotic, and enhanced immunity of the body , used as an additive in health care products is beneficial to improve the use effect and economic value of health care products.

[0024] The preparation steps of the spinosa polysaccharide include: cell wall crushing; polysaccharide crude extraction; polysaccharide extraction and separation and purification, the specific preferred steps are as follows:

[0025] 1) Cell wall fragmentation: take 16 parts of pine algae powder and soak them in absolute ethanol to degrease, extract the solid residue with water, the ratio of solid to liquid is 1:12m / V, stir for 10 minutes, seal and let it stand for 4 hours, add 0.28% activity of pine algae powder by weight Polypeptide, the amino acid sequence of the active polypeptide is: HSHACSYYCSNFCHGSCTRHSYLCH...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses the application of a spinosa polysaccharide for anticoagulation, which belongs to the technical field of polysaccharide application. The spinosa polysaccharide of the present invention is used as an additive in health care products with an anticoagulant function, and is combined with steam by an active polypeptide before extracting the polysaccharide The blasting technology improves the yield and purity of polysaccharides, and the acid water method is used to degrade the polysaccharides of P. spinosa, which improves the anticoagulant effect of the polysaccharides, and the extraction process of the polysaccharides is simple and the extraction cost is low.

Description

technical field [0001] The invention belongs to the technical field of polysaccharide application, and in particular relates to the application of anticoagulant pine algae polysaccharide. Background technique [0002] Echinococcus genus Chlorophyta is a perennial worldwide warm temperate marine plant. Traditional Chinese medicine believes that Echinococcus is sweet, salty and cold in nature, and has the effects of clearing heat and detoxifying, reducing swelling and diuresis, and repelling insects. Some scholars have found that the hot water extracts from the Argentinian and Korean seas have anticoagulant activity. [0003] The main components of C. chinensis are carbohydrates, accounting for 66.86%, of which insoluble dietary fiber accounts for 43.04%; protein content is relatively high, accounting for 21.67%, essential amino acids account for 42.2% of the total amino acids, and the limiting amino acids are methionine and cystine. The amino acid score is 86, the amino acid...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A23L33/125C08B37/00
Inventor 邢晓丹
Owner 浦江县昂宝生物技术有限公司
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com