Construction method and application of TIGIT humanized mouse model

A mouse model, humanized technology, applied in the field of animal genetic engineering and genetic modification to ensure the success rate

Active Publication Date: 2019-03-19
GEMPHARMATECH CO LTD
View PDF4 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0007] The key to a suitable humanized animal model lies in the strategy of gene modification. Some TIGIT humanized mouse models currently on the market are humanized only with the IgV domain in the extracellular region; The coding sequence and the mouse transmembrane and intr...

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Construction method and application of TIGIT humanized mouse model
  • Construction method and application of TIGIT humanized mouse model
  • Construction method and application of TIGIT humanized mouse model

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0049] Example 1: Establishment of C57BL / 6-TIGIT humanized mouse model

[0050] 1. Determine the replacement region of the human fragment and the inserted human sequence

[0051] According to the binding domain of human TIGIT and PVR protein, we selected Exon1, intron1, Exon2, intron2 and Exon3 (transcript NM_173799.3) of human TIGIT gene sequence (Gene ID: 201633) to replace Exon1 and intron1 of mouse TIGIT , Exon2, intron2 and Exon3 (transcript NM_001146325.1), the transmembrane region and intracellular region of mouse TIGIT are retained, and the replacement strategy is shown in the figure figure 2 shown. The chimeric sequence of the replaced protein is as follows, the underlined part is the human replacement region:

[0052] MRWCLLLIWAQGLRQAPLASG MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAIC NADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQIP LGGTMAAAVLGLICLMVTGVTVLARKKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKT...

Embodiment 2

[0087] Example 2 Human TIGIT expression and immune system verification in B6-hTIGIT mice

[0088] The expression of TIGIT homozygous mice was analyzed by flow cytometry and the immune cell population was checked. After analysis, the mice that could successfully express the humanized gene and did not cause obvious abnormalities in the immune system were available for tumor drug efficacy experiments.

[0089] 1. Protein expression detection

[0090] Thymus or spleen was selected as the main expression tissue of TIGIT, and the expression of TIGIT protein in the tissue was detected.

[0091] TIGIT protein flow detection method:

[0092] a) Sampling: Spleens were cut from B6-hTIGIT homozygous mice and C57BL / 6 background mice (see mouse information list), weighed, and placed in C-tubes.

[0093] b) Digestion: Peripheral blood was protected from light at room temperature and washed once with FACS buffer; spleen and thymus were digested with enzyme solution (PBS containing Ca, Mg+2%...

Embodiment 3B6

[0112] Example 3B6-hPD1 / hTIGIT mouse expression and functional verification of human TIGIT and PD1

[0113] 1. Mating PD1 pure and humanized mice with TIGIT humanized mice to obtain PD1 heterozygous TIGIT heterozygous humanized mice, male mice and PD1 pure and humanized mice were subjected to IVF to obtain a large number of PD1 pure and TIGIT heterozygous humanized mice, when the PD1 pure and TIGIT heterozygous humanized mice reach the appropriate age, the siblings are mated to obtain PD1 and TIGIT double pure and humanized mice, identification scheme and identification results As follows, the obtained PD1 and TIGIT double pure and humanized mice are numbered 148, 155, 161, 168, 172, 177-180, 182, 194#.

[0114] PCR Primer Information

[0115]

[0116]

[0117] Figure 8 – Figure 11 The electrophoresis identification diagram during the preparation of B6-hPD1 / hTIGIT mice is shown, in which Figure 9 The identification results of TIGIT-KI-target 5-end and 3-end are sh...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention provides a method for preparing a TIGIT humanized mouse model. According to the method, TIGIT extracellular regions and introns of gene sequences of extracellular regions of a mouse arepartially humanized, all sequences including introns and UTR in transmembrane regions and extracellular regions of the mouse are still mouse sources, and the internal regulatory sequences and completeintracellular signal transduction capacity of the genes are preserved in the manner; and by virtue of a humanized model constructed by the method, the original endogenous expression property of TIGITis realized, humanized regions (antibody combination regions) are maximized, the missing of an effective antibody is avoided, and the humanized model can be used for screening and evaluating drugs aiming at human TIGIT genes and is a very ideal preclinical drug testing model.

Description

technical field [0001] The invention belongs to the field of animal genetic engineering and genetic modification, and in particular relates to a method for constructing a TIGIT gene modified humanized animal model based on gene editing technology. Background technique [0002] In recent years, tumor immunotherapy has developed rapidly and has become the fourth-generation conventional treatment for tumors. The idea of ​​tumor immunotherapy is mainly carried out from the two aspects of targeting tumor cells and activating immune cells. There are four main categories of therapies that activate immune cells: tumor vaccines, non-specific cytokine therapy, cell therapy, and immune checkpoint inhibitors. Among them, immune checkpoint inhibitors are the main force in the development of new drugs for tumor treatment, and immune checkpoint inhibitors including PD1, PDL1 and CTLA4 have shown significant anti-tumor efficacy. Although these immune checkpoints have achieved considerable...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
IPC IPC(8): C12N15/85C12N15/113C12N15/12C12N15/90A01K67/027
CPCA01K67/0276A01K67/0278C12N15/113C12N15/8509C12N15/907C07K14/47A01K2267/0331A01K2217/072A01K2217/075A01K2227/105A01K2207/15C12N2310/20C12N2310/10
Inventor 赵静琚存祥杨笑柳张明坤侯欢欢高翔
Owner GEMPHARMATECH CO LTD
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap