376 results about "Tumor vaccines" patented technology

The invention includes compositions and methods for enhancing immunopotency of an immune cell by way of inhibiting a negative immune regulator in the cell. The present invention provides vaccines and therapies in which antigen presentation is enhanced through inhibition of negative immune regulators. The present invention also provides a mechanism to break self tolerance in tumor vaccination methods that rely on presentation of self tumor antigens.

A humanized form of an anti-idiotype antibody to CEA, e.g., hWI2, has conserved immunoreactivity. The clinical benefits of anti-CEA antibodies are maximized by using the humanized anti-idiotype as a clearing agent for anti-CEA antibodies or antibody fragments. The humanized anti-idiotype also can be used as an immunogenic vaccine.

The invention belongs to the field of medicinal biotechnology, and in particular relates to a recombinant human Claudin18.2 tumor vaccine and a preparation method thereof. The invention aims to solve the problems of immunotherapy for stomach cancer, pancreatic cancer, esophagus cancer and metastatic and non-metastatic ovarian cancer, such as high after-excision recurrence rate, strong chemo-treatment and radiation treatment toxic side effect and high monoclonal antibody therapy cost. The invention adopts a technical proposal that the recombinant human Claudin18.2 tumor vaccine has a sequence of HMKSSQYIKANSKFIGEFDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAV. Animal experiments prove that rhClaudin18.2 fusion protein can induce high-titre neutralizing antibody in the bodies of tumor-bearing mice by over 1:10,000; the antibody can be combined with human KATOIII and PANC-1 tumor cells and mouse stomach cancer MFC and pancreatic cancer MPC-83 cells; and the protein serving as a tumor vaccine can suppress the growth of the stomach cancer MFC and pancreatic cancer MPC-83 cells in the bodies of the mice.

The present invention provides compositions and methods for generating and cryopreserving dendritic cells with superior functionality in producing stronger signals to T cells, resulting in a more potent DC-based anti-tumor vaccine. The present invention includes mature, antigen loaded DCs activated by Toll-like receptor agonists that induce clinically effective immune responses, preferably when used earlier in the disease process. The DCs of the present invention produce desirable levels of cytokines and chemokines, and further have the capacity to induce apoptosis of tumor cells. The cells can be cryopreserved and thawed for later use, thereby reducing the need for repeated pheresis and elutriation processes during vaccine production. These methods can also be utilized to directly target molecules involved in carcinogenetic signaling pathways and cancer stem cells.

An anticancer vaccine of recombinant human MOC1-MBP fusion protein is disclosed, in which MBP is used as its adjuvant. The MBP gene and MUC1 gene are fused together. The MBP substituted for other fusion protein to induce CTL reaction. The pMAL-P2 is the carrier for effectively expressing maltose fusion protein. The serial repetitive sequence of MUC1 is inserted to downstream of malE gene.

The present invention provides methods of treating and enhancing efficacy of immunotherapy for a solid tumor in a subject, comprising the step of contacting the subject with a compound or composition that modulates the expression or activity of ETRB, ET-1, ICAM-1, or another protein found herein to play a role in homing of T cells to a solid tumor. The present invention also provides methods of prognosticating a solid tumor in a subject, comprising the step of measuring an expression level of a protein found herein to play a role in homing of T cells to a solid tumor, or a nucleotide molecule encoding same.

A tumor vaccine which comprises a microparticle or a lysate prepared from a solidified tumor material selected from the group consisting of a tumor tissue, a tumor cell, and a component thereof, and at least one cytokine and/or cytokine-inducing agent (e.g., a granulocyte-macrophage-colony stimulating factor and/or interleukin-2 and the like), and optionally an adjuvant. The vaccine can be easily prepared and widely applied for prevention of recurrence, inhibition of metastasis and therapeutic treatment regardless of a type of a tumor, and has excellent antitumor effect.

The present invention relates to tumor associated antigen (TAA) peptides and to use of same, of polynucleotides encoding same and of cells presenting same as anti-tumor vaccines. More particularly, the present invention relates to tumor associated antigen peptides derived from Uroplakin Ia, Ib, II and III, Prostate specific antigen (PSA), Prostate acid phosphatase (PAP) and Prostate specific membrane antigen (PSMA), BA-46 (Lactadherin), Mucin (MUC-1), and Teratocarcinoma-derived growth factor (CRIPTO-1) and the use of same as anti-tumor vaccines to prevent or cure bladder, prostate, breast or other cancers, carcinomas in particular. Most particularly, the present invention relates to tumor associated antigen peptides which are presentable to the immune system by HLA-A2 molecules.

A therapeutic composition or a vaccine comprising tumor membrane-anchored cytokines or other immunostimulatory or costimulatory molecules are provided. The therapeutic composition or a tumor vaccine can be used for treating a tumor or other disease such as autoimmune disorder, viral diseases, bacterial diseases, parasitic diseases, and transplant rejection.

Compositions and methods are provided which can be utilized in active immunization as a prophylactic treatment or a therapeutic treatment for tumors. The compositions are employed as injectable tumor vaccines or as preparations for intratumoral administration and are capable of stimulating immune responses to specific tumor antigens. The tumor vaccines are composed of an antigenic cellular material including a plurality of inactivated tumor cells or tumor cell portions, a depot material, and an immunostimulant adsorbed to the depot material. The depot material with absorbed immunostimulant is mixed with the tumor cells or tumor cell portions to form the vaccine compositions. The preparations for intratumoral administration include the depot material adsorbed immunostimulant without the antigenic cellular material. The immunostimulant adsorbed to the depot material permits release of biologically active quantities of the immunostimulant over a period of time rather than all at once.

The invention discloses an HLA-G (Human Leukocyte Antigen G) antigenic determinant and a sequence position thereof as well as a method for preparing an HLA-G antibody by utilizing the HLA-G antigenic determinant. An ultra-sensitive chemiluminescence immunoassay kit and the like are prepared by utilizing the HLA-G antibody and used for detecting an extremely low content of HLA-G in the body fluid of an early tumor patient so as to diagnose early tumors; a kit which has the advantages of easy and convenient operation without using an instrument and self-check and self-test function and detects the HLA-G through gold-marking immunoassay is prepared by utilizing the HLA-G antibody and used for basic screening and early tumor monitoring to eliminate the tumors in early stage so as to enhance the survival rate of tumor patients; and a broad-spectrum antitumor biological agent and a broad-spectrum tumor vaccine are prepared by utilizing the HLA-G antibody as an important raw material and used for treating and preventing malignant tumors.

The present invention provides an antigen-presenting cell(APC)/tumor cell conjugate, wherein the antigen-presenting cell (APC) is modified by a cytokine gene selected from the group consisting of IL-2, IL-3, IL-4, IL-6, IL-12, IL-18, IFNα, IFNβ, IFNγ, TNF, TGF, GM-CSE, and the combination thereof. The conjugate is useful as a tumor vaccine to significantly induce an immunity specifically against the tumor cell The present invention also provides the method for preparing the conjugate and a pharmaceutical composition containing said conjugate.

The invention relates to a tumor antigen prediction method based on a whole transcriptome. The tumor antigen prediction method includes the steps: respectively performing protein generation and peptide fragment interception of tumor-associated antigen, detection of tumor somatic mutation and corresponding mutant peptide fragment interception, generation of tumor-specific novel transcript and peptide fragment interception, and gene fusion detection and fusion peptide fragment interception in tumor tissues, according to the whole transcriptome sequencing data of tumor tissues and corresponding adjacent para-carcinoma tissues, obtaining tumor-associated antigen, tumor somatic mutation, tumor novel transcript, tumor-specific peptide fragment of gene fusion, calculating affinity of the obtainedtumor-specific peptide fragment and the HLA molecule and the amount of expression in each transcript, and based on the affinity value of the tumor-specific peptide fragment and the amount of expression TPM (transcripts per million) value, evaluating the level of the candidate tumor antigen. The invention also provides an application of the same. The tumor antigen prediction method based on a whole transcriptome and the application of the same are conductive to accurate calculation of the tumor antigen load, evaluation of immunological therapy effect, and tumor vaccine design of the later stage of service.

The invention provides short chain polypeptide, application thereof as a vaccine adjuvant and a vaccine with the short chain polypeptide serving as the adjuvant. A capping group having an anti-inflammatory effect is introduced into the short chain polypeptide, and can form hydrogel, and the hydrogel being simply and physically mixed with an antigen can effectively enhance the immune response ability of the antigen, and is used in a preventive tumor vaccine for completely inhibiting tumor growth. The sequence of the short chain polypeptide is X-GDFDFDY, wherein X is Fbp or Car.

The invention provides a preparation method and application of a new therapeutic vaccine for dendritic tumor cells. The therapeutic tumor vaccine is chemotherapeutic drug induced tumor antigen, wherein, the dendritic cells are loaded and activated. The chemotherapeutic medicament induced tumor antigen contains a plurality of immunostimulation molecules as well as tumor-associated and specific antigen, which can remarkably carry out chemotaxis and activation on immunocytes such as the dendritic cells, T-cells (thymus-dependent lymphocytes) and the like, stimulate the dendritic cells to be mature and express a plurality of cell factors and chemotactic factors, effectively induce immune response reaction with antigenic specificity and non-specificity and strengthen body immune function. The therapeutic vaccine provided by the invention can be used for preventing and treating tumors and has the characteristics of simple preparation process, low cost, strong specificity, obvious curative effect and the like.

It has been discovered that reducing, inhibiting or preventing the expression of immunosuppressive cytokines or tolergenic agents in antigen presenting cells improves the ability of the antigen presenting cell to promote an immune response. One embodiment provides a genetically engineered antigen presenting cell that has reduced or no expression of IL-10. Preferred antigen presenting cells are dendritic cells. Expression of IL-10 can be inhibited or blocked by genetically engineering the antigen presenting cell to express inhibitory nucleic acids that inhibit or prevent the expression mRNA encoding immunosuppressive cytokines. Inhibitory nucleic acids include siRNA, antisense RNA, antisense DNA, microRNA, and enzymatic nucleic acids that target mRNA encoding immunosuppressive cytokines. Immunosuppressive cytokines include, but are not limited to IL-10, TGF-β, IL-27, IL-35, or combinations thereof. Tolerogenic agents include but are not limited to indoleamine 2,3-dioxygenase.

The invention relates to colon and prostate tumor associated antigen peptides obtainable from prostate specific G protein-coupled receptor (PSGR), six-transmembrane epithelial antigen of prostate (STEAP) and proteins encoded by genes found overexpressed in colon carcinoma cells, such as human 1-8D interferon induced transmembrane protein 2. The invention further relates to a polynucleotide encoding the tumor associated antigen peptides and to pharmaceutical compositions, which are preferably anti-tumor vaccine compositions, containing a tumor associated antigen, at least one tumor associated antigen peptide thereof, or encoding polynucleotide thereof as an active ingredient. The pharmaceutical compositions can be administered to a patient in need thereof to treat or inhibit the development of colon or prostate cancer.

The invention relates to a bi-function ligand targeting dendritic cell tumor vaccine and a preparation method thereof. The method comprises the following steps: S1)preparing mannose modified nanoliposomes; S2)connecting CpG-ODN to the nanoliposomes to obtain the bi-function ligand modified nanoliposomes; S3)extracting tumour antigen peptide from tumor cells by a repeated thawing-freezing method; and S4) coating tumour antigen peptide by the ligand modified nanoliposomes by a freeze-drying-rehydration method. According to the invention, the bi-function ligand modified nanoliposomes can be taken as a carrier, mannose molecules on surface of liposome is specifically targeted to dendritic cells, CpG-ODN is combined to a Toll acceptor 9 in the dendritic cells for promoting the maturation of dendritic cells, matured dendritic cells enables high efficiency presentation of tumour antigen peptide released from inner part of nanoliposomes, T lymphocyte can be activated, and specific antineoplastic effect is generated.

Said invention provides tumor antigen mRNA sensitized dendritic cell tumor vaccine, preparation and use thereof, and medicinal composition of dendritic cell. Said tumor vaccine is specific mRNA modified dendritic cell vaccine which can stimulate body to produce specific immune response aiming at HER2 positive tumor, so it can be used in preventing and curing HER2 positive tumor such as breast cancer etc. said invention has high transfection efficiency, wide anti tumor gammarayspectrum and strong specificity.