Quick quantitative detection method and kit for human copeptin
A quantitative detection and kit technology, applied in the field of biomedicine, can solve the problems of limiting the clinical value of CPP, no clinical use, long detection time, etc., and achieve the effect of increasing clinical application value, increasing immune response, and improving effective presentation
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
preparation example Construction
[0042] The present invention provides a kit for rapid quantitative detection of human and peptidin, which is characterized by comprising: a human and peptidin monoclonal antibody, and the anti-human and peptidin monoclonal antibody is prepared by the following method:
[0043]Immunize mice with human and peptidin antigens; deliver cytokine-expressing plasmids to immunized mice; collect spleen cells or lymph node cells from the plasmid-delivered mice, and combine the spleen cells or lymph node cells with mouse bone marrow The tumor cells are fused to obtain hybridoma cells, which are cultured and secreted to obtain anti-human and peptidin monoclonal antibodies.
[0044] Optionally, the human and peptidin antigen is a polypeptide comprising the amino acid sequence of SEQ ID NO:1, SEQ ID NO:2 or SEQ ID NO:3. Preferably, the human and peptidin antigens are human and peptidin antigens coupled with macromolecular proteins, and the macromolecular proteins are preferably at least one ...
Embodiment 1
[0060] Example 1 Preparation method of high-affinity anti-human and peptidin monoclonal antibody
[0061] 1.1 Peptide synthesis
[0062] Copeptin antigen polypeptides (cppF, N-cpp, C-cpp) were synthesized and coupled with KLH to prepare complete antigens to obtain KLH-cppF, KLH-N-cpp, and KLH-C-cpp. The amino acid sequence is:
[0063] cppF: ATQLDGPAGALLLRLVQLAGAPEFEPAQPDAY (SEQ ID NO: 1),
[0064] N-cpp: CATQLDGPAGALLLRLV (SEQ ID NO: 2),
[0065] C-cpp: CLAGAPEPFEPAQPDAY (SEQ ID NO:3)
[0066] That is, the complete antigen obtained by coupling KLH is:
[0067]KLH-cppF(KLH-C-ATQLDGPAGALLLRLVQLAGAPEFEPAQPDAY);
[0068] KLH-N-cpp(KLH-C-ATQLDGPAGALLLRLV);
[0069] KLH-C-cpp(KLH-C-LAGAPEPFEPAQPDAY);
[0070] The peptide synthesis and coupling were carried out by conventional methods, and were entrusted to Gill Biochemical Shanghai Co., Ltd. The purity was determined by high performance liquid chromatography (HPLC), and all were >95%.
[0071] 1.2 Plasmid construction
[...
Embodiment 2
[0087] Embodiment 2 Immune effect and antibody titer determination
[0088] Cytokine group: The immunization strategy described in Example 1: that is, a cytokine tail vein injection was performed once a week after each subcutaneous immunization.
[0089] Control group 1: Compared with Example 1, no cytokine tail vein injection was performed after each immunization, and the remaining steps were the same as those of Example 1.
[0090] Control group 2: Compared with Example 1, the plasmids expressing cytokines: pCAGGS-mFlt3L and pCAGGS-mGM-CSF were injected through the tail vein one week after the initial immunization of the subcutaneous injection of the site, i.e., compared with the experimental group, pCAGGS-mCCL20 was not injected.
[0091] The comparison results of the immune effects of the above two groups are shown in Table 1.
[0092] Table 1 Comparison of immune effects
[0093]
[0094]
[0095] As can be seen from Table 1, the cytokine group was immunized by t...
PUM

Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com