Antibody of mature brain-derived neurotrophic factor and its application and diagnostic kit

A neurotrophic factor, diagnostic kit technology, applied in application, disease diagnosis, anti-growth factor immunoglobulin, etc., can solve problems such as lack of specific antibodies and differences in processing methods

Active Publication Date: 2022-07-29
RESEARCH INSTITUTE OF TSINGHUA UNIVERSITY IN SHENZHEN
View PDF7 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, due to differences in the processing methods of samples (such as serum and plasma), more importantly, there are two forms of BDNF, precursor BDNF (ProBDNF) and mature BDNF (mBDNF), and there is currently a lack of highly specific antibodies against mBDNF

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Antibody of mature brain-derived neurotrophic factor and its application and diagnostic kit
  • Antibody of mature brain-derived neurotrophic factor and its application and diagnostic kit
  • Antibody of mature brain-derived neurotrophic factor and its application and diagnostic kit

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0048] Screening of anti-mBDNF antibodies

[0049] The amino acid sequence (SEQ ID NO. 11) of the antigen mBDNF used is as follows:

[0050] HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.

[0051] The above mBDNF protein was used as the antigen for immunization and the antigen for screening. The immunized animals were 6-8 week old female Balb / c mice, injected with antigen, and rapidly immunized with special adjuvant for about two weeks. After immunizing the animals, the antibody titer was detected, and when the antibody titer was high enough, the animals were anesthetized with isoflurane and then sacrificed, and the lymph nodes were harvested and fused with myeloma after digestion. Sp2 / 0 myeloma cells were cultured in DMEM, and when the cells were in good condition and the viable cell rate was over 80%, they were fused with lymphocytes through polyethylene glycol. The cells were then cultured in HAT s...

Embodiment 2

[0065] Purification of anti-mBDNF antibodies

[0066] The antibody gene sequence measured above was codon-optimized, synthesized and inserted into the vector of pcDNA3.4, and the Fc region adopted the sequence of the original antibody subtype IgG2b. The constructed expression vector was transferred into Escherichia coli for amplification and expression, and the expression plasmid was purified. The plasmid was electrotransfected into 293 cells. After 2 days of culture, the antibody protein in the supernatant was extracted, and the protein A affinity column was used for Antibodies were purified and characterized using HPLC-SEC and SDS-Page to determine their concentration and purity. After testing, the antibody concentration was 0.862 mg / ml, and the purity reached 98%.

Embodiment 3

[0068] Specific detection of anti-mBDNF antibodies

[0069] Antigen sample: mBDNF (amino acid sequence shown in SEQ ID NO.11) or ProBDNF is detected by ELISA method:

[0070] 1) Coating: Coat a 96-well plate with 50 μl of mBDNF or proBDNF protein at a concentration of 2 μg / ml at 4°C overnight, the concentration is shown in Table 2, then wash the plate three times with PBST (Tween 0.05%) and pat dry.

[0071] 2) Blocking: Add 200 μl of blocking solution (PBST solution containing 1% BSA) to a 96-well plate with the configured blocking solution, block for 1 hour at room temperature, wash the plate four times, and pat dry.

[0072] 3) Add 50 μl of sample (purified antibody of Example 2 above), incubate at room temperature for 1 hour, wash the plate four times, and pat dry.

[0073] 4) Secondary antibody incubation: Secondary antibody (1:2000) was prepared with blocking solution, 100 μl of secondary antibody was added to each well, incubated at room temperature for 1 hour, washed ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses an antibody of a mature brain-derived neurotrophic factor, its application and a diagnostic kit, and relates to the technical field of antibodies. The mature brain-derived neurotrophic factor antibody disclosed in the present invention has the heavy chain complementarity determining region shown in SEQ ID NO.1-3 and the light chain complementarity determining region shown in SEQ ID NO.4-6. The antibody can specifically recognize mature brain-derived neurotrophic factor with high specificity and sensitivity.

Description

technical field [0001] The present invention relates to the technical field of antibodies, in particular, to an antibody of mature brain-derived neurotrophic factor and its application and diagnostic kit. Background technique [0002] As the most widely distributed neurotrophic factor (BDNF) in the central nervous system, the function and levels of BDNF are closely related to various neurological diseases, such as Alzheimer's disease (Allen et al., 2011). A study of samples from patients with Alzheimer's disease (AD) and its early symptoms of MCI showed that the levels of BDNF in brain regions such as hippocampus and cortex of patients were reduced to varying degrees compared with normal human samples (Peng et al., 2005). Since BDNF can partially cross the blood-brain barrier, the level of BDNF in the cerebrospinal fluid is highly correlated with its peripheral level. In recent years, research on AD and peripheral BDNF levels has gradually increased. A meta-analysis publis...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityPatents(China)
IPC IPC(8): C07K16/22C12N15/13G01N33/68
CPCC07K16/22G01N33/74C07K2317/565C07K2317/34C07K2317/56G01N2333/4756G01N2800/044G01N2800/304G01N2800/302G01N2800/2835G01N2800/2821G01N2800/2871G01N2800/2878G01N2800/36
Inventor郭炜
OwnerRESEARCH INSTITUTE OF TSINGHUA UNIVERSITY IN SHENZHEN