Prawn immunopotentiator based on RNA interference technology and preparation method and application of prawn immunopotentiator
A technology of prawns and inhibitors, applied in the direction of recombinant DNA technology, biochemical equipment and methods, DNA/RNA fragments, etc., can solve the problems that it is difficult to meet the large dose of interference application, the application has not been effectively developed, and the synthesis cost is high. The effect of low output cost, rapid growth and low cultivation cost
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0063] In order to make the object, technical solution and technical effect of the present invention clearer, the present invention will be further described in detail below in conjunction with specific embodiments. It should be understood that the specific implementations described in this specification are only for explaining the present invention, not for limiting the present invention.
[0064] The experimental materials and reagents used are conventional consumables and reagents that can be obtained from commercial channels unless otherwise specified.
[0065] Discovery of target proteins
[0066]The inventor found through research that there is an orphan nuclear receptor homologous protein LvFtz-F1β in the prawn body, and its amino acid sequence is:
[0067] MWSEEPSTSDLMCDIMLSRGHGGQGRFSLQNLILGQHITSKLEEQMRVDAEEPMSPMSPMSQGSDHDHDKPTVRQVKVEESGSEEQTVFSSQPASQTDSPVPPRSDSGCEVHPGPYTPSQSPLLPRLHPHTHSPTHLYSPTQSPGPSRHVSGFSSPYSHTPSTGLSRNNSDASQYGGSYNSYSSAPSPISPTHYSPSQSPIQQRHITYQMPPHQS...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


