Unlock instant, AI-driven research and patent intelligence for your innovation.

Prawn immunopotentiator based on RNA interference technology and preparation method and application of prawn immunopotentiator

A technology of prawns and inhibitors, applied in the direction of recombinant DNA technology, biochemical equipment and methods, DNA/RNA fragments, etc., can solve the problems that it is difficult to meet the large dose of interference application, the application has not been effectively developed, and the synthesis cost is high. The effect of low output cost, rapid growth and low cultivation cost

Active Publication Date: 2021-08-06
SUN YAT SEN UNIV
View PDF7 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

Among them, for the chemical synthesis method, its synthesis cost is high, the efficiency is low, and it is difficult to meet the high-dose interference application; and the biosynthesis method can be divided into eukaryotic cell level synthesis and prokaryotic cell level synthesis, both of which are based on dsRNA or siRNA The expression vector expresses the interfering RNA required for the application in the host cell. The difference is that one of the host cells is a eukaryotic cell and the other is a bacterium. However, in related technologies, the biosynthesis method only stays at inhibiting insect At the level of growth and reproduction, the application in other more complex organisms has not been effectively developed

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Prawn immunopotentiator based on RNA interference technology and preparation method and application of prawn immunopotentiator
  • Prawn immunopotentiator based on RNA interference technology and preparation method and application of prawn immunopotentiator
  • Prawn immunopotentiator based on RNA interference technology and preparation method and application of prawn immunopotentiator

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0063] In order to make the object, technical solution and technical effect of the present invention clearer, the present invention will be further described in detail below in conjunction with specific embodiments. It should be understood that the specific implementations described in this specification are only for explaining the present invention, not for limiting the present invention.

[0064] The experimental materials and reagents used are conventional consumables and reagents that can be obtained from commercial channels unless otherwise specified.

[0065] Discovery of target proteins

[0066]The inventor found through research that there is an orphan nuclear receptor homologous protein LvFtz-F1β in the prawn body, and its amino acid sequence is:

[0067] MWSEEPSTSDLMCDIMLSRGHGGQGRFSLQNLILGQHITSKLEEQMRVDAEEPMSPMSPMSQGSDHDHDKPTVRQVKVEESGSEEQTVFSSQPASQTDSPVPPRSDSGCEVHPGPYTPSQSPLLPRLHPHTHSPTHLYSPTQSPGPSRHVSGFSSPYSHTPSTGLSRNNSDASQYGGSYNSYSSAPSPISPTHYSPSQSPIQQRHITYQMPPHQS...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses a prawn immunopotentiator based on an RNA interference technology and a preparation method and application of the prawn immunopotentiator. According to the prawn immunopotentiator, expression of LvFtz-F1 beta2 genes of litopenaeus vannamei is specifically interfered through dsRNA, a prawn JAK / STAT signal channel is activated, the immunity of prawns is enhanced, and the resistance of the prawns to pathogens is improved. After the prawn immunopotentiator is eaten by the prawns, the dsRNA is immediately absorbed by intestinal tracts along with digestion of feed, and the dsRNA entering the intestinal tracts plays a role in the intestinal tracts and is transported to other tissues and organs along with an open circulatory system of the prawns to finally cause systemic RNA interference. Moreover, the preparation cost is low, large-scale use in an industrial aquaculture system is easy, the specificity is high, the safety is high, and the prawn immunopotentiator has important significance in promoting the development of the prawn aquaculture industry.

Description

technical field [0001] The invention belongs to the field of aquaculture, and in particular relates to a prawn immune enhancer based on RNA interference technology and its preparation method and application. Background technique [0002] Litopenaeus vannamei, commonly known as Penaeus vannamei, belongs to Arthropoda, Crustacea, Decapod, Penaeidae, Litopenaeus genus, because of its fast growth rate, high meat content, rich protein, disease resistance and stress resistance Strong and other characteristics, it is the main species of shrimp farming in the world. With the rise of the global economic level, people's living standards and consumption capacity are upgraded accordingly, and the market demand for prawns is increasing day by day. Fishing prawns from the wild can no longer satisfy the market's demand for healthy prawns. Driven by the huge market demand, the prawn farming industry has developed vigorously. However, with the expansion of the scale of shrimp farming and t...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): A61K31/713C12N15/113A61P37/04A61P31/04
CPCA61K31/713C12N15/113A61P37/04A61P31/04C12N2310/14C12N2320/30
Inventor 左洪亮徐晓鹏翁可佳何建国翁少萍朱志明
Owner SUN YAT SEN UNIV