Preparation for self-protein used as carrier protein for hapten-antibody
A carrier protein and hapten technology, applied in the direction of anti-animal/human immunoglobulin, etc., can solve the problems of unfavorable antibody titer and specificity, influence, etc.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0024] Example 1 Preparation of FK506 polyclonal antibody
[0025] FK506 is a macrolide antibiotic, consisting of a semiketone group, α, β diketone group and 23 rings, and its molecular formula is C 44 h 69 NO 12 ·H 2 O, the molecular weight is 822. Its structural formula is shown in Figure 2. It alone cannot be used as an antigen to immunize animals to obtain specific antibodies, and needs to be coupled with a carrier protein to obtain immunogenicity. We obtained derivatives of FK506 by anhydride method, and then coupled with autologous serum albumin by EBC method. Specific steps are as follows:
[0026] 1) Dissolve 20 mg of FK506 in 5 ml of pyridine, add 50 mg of glutaric anhydride, and react at 80°C for 4 hours at reflux, and use silica gel thin-layer chromatography to detect the progress of the reaction, and stop the reflux reaction when the reaction is nearly complete;
[0027] 2) solvent pyridine is removed by distillation under reduced pressure to obtain FK506 gl...
Embodiment 2
[0047]Example 2 BNP is coupled to serum albumin using a bifunctional cross-linking agent
[0048] The amino acid sequence of BNP (B-type natriuretic peptide, brain natriuretic peptide) is SSKMYQGSGCPGFKMDRLSSSSGLGCKVLRRR from the amino terminal to the carboxyl group. It is a peptide containing 32 amino acid residues. The relative molecular mass of BNP is 3.46×10 3 , it is not sufficient as a complete antigen to immunize animals, and needs to be conjugated to a carrier protein to obtain immunogenicity. Conjugate with serum albumin using a bifunctional cross-linker method. Specific steps are as follows:
[0049] 1) Dissolve 1mg of brain nasin (BNP) in 1ml of double distilled water; 10mg of self-made rabbit serum albumin, dissolve in 1ml of PBS (pH 7.5) with a concentration of 1mol / L;
[0050] 2) shake and mix the hapten solution and the rabbit serum albumin solution;
[0051] 3) Add 1 ml of 0.25% (volume ratio) glutaraldehyde dropwise while stirring. Stir for 5-10 minutes af...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 
