Optimized acid-resistant mannase MAN26gy as well as preparation method and application thereof
A technology of mannanase and acid resistance, which is applied in the field of genetic engineering and enzyme engineering, and can solve the problem that the energy utilization rate is only 50-60%.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0022] 1. Site-directed mutation of GH26β-mannanase gene
[0023] The mannanase MAN26gy of the present invention is derived from Bacillus subtilis (it can be derived from commercially available Bacillus subtilis, such as purchased from the Agricultural Microorganism Culture Collection Center, its number is ACCC01779), the amino acid sequence of mannanase MAN26gy As the following SEQ ID No:1:
[0024] LFKKHTISLLILFLLASAVLAKPIEAHTVSPVNPNAQQTTKAVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSATG L SPAIYGCDYARGWLETA N IEDSIDVSCNGDLISYWKNGGIPQISLHLANPAFQSGHFKTPITNDQYKKILDSSTAEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERISLYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVLTALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSPAVNKGASALYHDSWTLNKGEIWNGDSLTPIVE。
[0025] Encoding the above-mentioned mannanase gene man26gy derived from Bacillus subtilis, its genome sequence is as follows SEQ ID No: 2:
[0026] Ttgtttaagaaacatacgatctctttgctcattttatttttacttgcgtctgctgttttagcaaaaccaattgaagcgcatactgt...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More - R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com
