Brucella Omp10 protein antigen epitope polypeptide and application thereof
A Brucella and protein antigen technology, applied in the field of peptides, can solve the problems of high cost of subunit vaccines, interfere with the differential diagnosis of natural infection of vaccines, complex composition components, etc., to ensure public health and animal product safety, and powerful antigen processing. and presentation ability, and the effect of improving the level of prevention and control technology
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0017] Below in conjunction with embodiment the present invention will be further described.
[0018] 1. Preparation of experimental materials
[0019] 1) Acquisition of antigenic epitope polypeptide
[0020] Using bioinformatics software to analyze the amino acid composition, properties and advanced structure of Brucella Omp25 protein, combine all the results, and mine seven polypeptide fragments that may be immunogenic, and entrust Nanjing GenScript Biotechnology Co., Ltd. The company synthesized and obtained the peptide sequences as follows:
[0021] NKAKTSTVGSIKPDDW (SEQ ID NO.3, polypeptide sample 1 in the content described later);
[0022] KNYDLAGTTVRNKLD (SEQ ID NO.4, polypeptide sample 2 in the content described later);
[0023] GDAGYSWAKKSKDGLE (SEQ ID NO.1, polypeptide sample 3 in the content described later);
[0024] IKLNNGLDGESKF (SEQ ID NO.5, polypeptide sample 4 in the content described later);
[0025] LKSLVIVSAALLPFSATAFAADAIQEQPPVPAPVEVAPQYS (S...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap