Brucella Omp10 protein antigen epitope polypeptide and application thereof

A Brucella and protein antigen technology, applied in the field of peptides, can solve the problems of high cost of subunit vaccines, interfere with the differential diagnosis of natural infection of vaccines, complex composition components, etc., to ensure public health and animal product safety, and powerful antigen processing. and presentation ability, and the effect of improving the level of prevention and control technology

Active Publication Date: 2016-06-22
LANZHOU INST OF VETERINARY SCI CHINESE ACAD OF AGRI SCI
View PDF3 Cites 6 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0003] At present, the effective vaccines used to prevent brucellosis all over the world are attenuated live vaccines. The use of various vaccines not only interferes with the differential diagnosis of vaccine immunity and natural infection, but also all vaccine strains are harmful to humans to varying degrees. Virus-causing, even some vaccines are highly pathogenic to humans, and the research effect of safe and reliable inactivated vaccines is poor, and they cannot play an immune protection role
The study of genetically engineered vaccines has been concerned and worked hard by researchers all over the world in recent decades. However, due to the diversity and complex structure of Brucella's immune antigens, vaccine antigens that can be used in field trials have not been found. It is an effective way to solve this problem by developing a subunit vaccine with high preventive protection.
[0004] Most of the expression tools in the prior art can only express one protein, while Brucella has a variety of immune-related proteins. Studies have shown that the expression of a single protein cannot form an effective protective vaccine antigen, and multiple prevention and control vaccines can be prepared by expression The cost of the subunit vaccine is high, and the composition is complex; while the component that determines the function of the immune protein is a tiny epitope located on the protein. The mining and identification of the immune epitope of the immune-related protein can effectively extract the brucellosis Effective immune antigen components in bacteria, and also provide direct guidance for protein structure and function research, the determination of epitope antigen components can provide good antigen components for detection, prevention or treatment

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Brucella Omp10 protein antigen epitope polypeptide and application thereof
  • Brucella Omp10 protein antigen epitope polypeptide and application thereof
  • Brucella Omp10 protein antigen epitope polypeptide and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0017] Below in conjunction with embodiment the present invention will be further described.

[0018] 1. Preparation of experimental materials

[0019] 1) Acquisition of antigenic epitope polypeptide

[0020] Using bioinformatics software to analyze the amino acid composition, properties and advanced structure of Brucella Omp25 protein, combine all the results, and mine seven polypeptide fragments that may be immunogenic, and entrust Nanjing GenScript Biotechnology Co., Ltd. The company synthesized and obtained the peptide sequences as follows:

[0021] NKAKTSTVGSIKPDDW (SEQ ID NO.3, polypeptide sample 1 in the content described later);

[0022] KNYDLAGTTVRNKLD (SEQ ID NO.4, polypeptide sample 2 in the content described later);

[0023] GDAGYSWAKKSKDGLE (SEQ ID NO.1, polypeptide sample 3 in the content described later);

[0024] IKLNNGLDGESKF (SEQ ID NO.5, polypeptide sample 4 in the content described later);

[0025] LKSLVIVSAALLPFSATAFAADAIQEQPPVPAPVEVAPQYS (S...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention discloses Brucella Omp10 protein antigen epitope polypeptide and application thereof. The polypeptide's amino acid sequence is SEQ ID No.1 or the polypeptide is formed by the sequence formed by SEQ ID No.1 with one or several amino acid residues replaced and/or lacked or could be derived from the amino acid sequence SEQ ID No.1 added with Brucella immunogenicity function. The polypeptide with SEQ ID No.1 can generate recombinant carriers or expression cassettes or transgenosis cells or recombinant bacteria. The invention further relates to application of the polypeptide in preparing reagent or medicine for diagnosing or preventing or treating diseases caused by Brucella. The polypeptide is chemically synthesized, can release high-concentration IL-4 under DC stimulation, can detect serum infected by brucellosis as target antigen, or prepare antigen of Omp 25 protein monoclonal antibody.

Description

technical field [0001] The invention relates to a polypeptide, specifically a Brucella Omp25 protein antigen epitope polypeptide and application thereof. Background technique [0002] Brucella, a Gram-negative facultative intracellular parasite, is a serious zoonotic disease that widely infects domestic animals, wild animals and humans. Brucella in domestic animal animals mainly infects sheep, cattle and pigs Among them, the main ones that are pathogenic to humans are Brucella malta and Brucella abortus; Brucellosis infecting domestic animals causes epididymitis in male animals and abortion, placental inflammation and infertility in pregnant animals; for humans, Brucella Bacteroidosis causes acute inflammation and many symptoms similar to influenza infection, including wave fever, sweating, back pain, and weakness. In some patients, acute clinical symptoms can last for more than a year and eventually lead to chronic persistent infection. Clinical symptoms include irregular ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/23G01N33/68G01N33/569A61K39/10A61P31/04
CPCA61K39/00C07K14/23G01N33/56911G01N33/68G01N2333/23
Inventor 曹小安周继章李兆才娄忠子景志忠付宝权尚佑军
Owner LANZHOU INST OF VETERINARY SCI CHINESE ACAD OF AGRI SCI
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products