Application of pilose antler peptide in promoting proliferation of mesenchymal stem cells

A technology of stem cells and velvet antler polypeptide, applied in the field of biomedicine, can solve the problems of high price of cytokines, difficult to widely use, etc., and achieve the effect of significant effect, promoting the repair of kidney damage and promoting the proliferation of ADSCs cells.
CN106367384AInactive Publication Date: 2017-02-01DALIAN UNIV OF TECH
1 Cites 7 Cited by

Patent Information

Authority / Receiving Office
CN Β· China
Patent Type
Applications(China)
Current Assignee / Owner
DALIAN UNIV OF TECH
Publication Date
2017-02-01
Estimated Expiration
Not applicable Β· inactive patent

Smart Images

  • Figure 1
    Figure 1
  • Figure 2
    Figure 2
  • Figure 3
    Figure 3
Patent Text Reader

Abstract

The invention belongs to the technical field of biological medicines, and discloses application of pilose antler peptide in promoting proliferation of mesenchymal stem cells. The pilose antler peptide which contains 32 amino acids obtained in the invention has an effect on proliferation of the ADSCs (Adipose Tissue-Derived Stromal Cells). The amino acid sequence of the pilose antler peptide is VLSATDKTNVLAAWGKVGGNAPAFGAEALERM. The pilose antler peptide has a most remarkable effect when the concentration of the pilose antler peptide is 20 ug / ml and the acting time is 48 hours, and is beneficial to promoting kidney damage repair and promoting skin wound healing and bone repair.
Need to check novelty before this filing date? Find Prior Art

Description

technical field

[0001] The invention belongs to the technical field of biomedicine and relates to the application of velvet antler polypeptides (VAPs) in promoting the proliferation of mesenchymal stem cells (ADSCs). Background technique

[0002] Antler - Returns to the liver and kidney meridians, nourishes kidney yang, nourishes essence and blood, and strengthens muscles and bones. Belongs to one of the traditional Chinese medicine. The Pharmacopoeia of the People's Republic of China (1st edition in 2005) describes the functions and indications of velvet antler as: strengthening kidney yang, benefiting essence and blood, strengthening muscles and bones, regulating Chong and Ren, and supporting sores. It is used for impotence and spermatorrhea, infertility due to cold palace, thinness, mental fatigue, chills, dizziness, tinnitus and deafness, cold pain in the waist and knees, cold and limp bones, metrorrhagia, vaginal discharge, and gangrene.

[0003] Antler is an animal b...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More