Patents
Literature
Hiro is an intelligent assistant for R&D personnel, combined with Patent DNA, to facilitate innovative research.
Hiro

54results about How to "Promote bone repair" patented technology

Degradable zinc base alloy implant material and preparation method and application thereof

The invention discloses a degradable zinc base alloy implant material and a preparation method and application of the degradable zinc base alloy implant material. The degradable zinc base alloy implant material comprises 0.01 wt%-14 wt% of Fe, 0 wt%-13 wt% of functional elements and the balance of Zn according to mass percentage. In the preparation, Zn, Fe and the functional elements are evenly mixed, and the mixture is placed in a high-purity graphite crucible, and smelted under the atmosphere of mixed gases SF6 and CO2, so as to obtain the degradable zinc base alloy implant material. The mechanical properties of the zinc base alloy implant material are remarkably improved, the implant material is easy to process and form, the properties like strength and plasticity meet the basic requirements of the body implant material of an intravascular stent, an orthopedic internal fixation system and the like; the introduction of the functional elements further enables the product to achieve the certain effects of resisting bacteria, maintaining and inducing angiogenesis, repairing bones, promoting calcification and being beneficial for recovery of body functions.
Owner:SHANDONG RIENTECH MEDICAL TECH +1

Polyether-ether-ketone bone repair material with multi-scale holes and preparation method thereof

The invention discloses a polyether-ether-ketone bone repair material with multi-scale holes and a preparation method thereof, and belongs to the technical field of medical biological materials. The preparation method comprises the following steps: firstly, hot-pressing polyether-ether-ketone granules into a plate, after cleaning and drying, obtaining a partially foamed polyether-ether-ketone plate in a supercritical carbon dioxide foaming device, conducting sulfonation in a mixed acid solution of concentrated sulfuric acid and methane sulfonic acid, and conducting hydrothermal treatment and vacuum drying to obtain the polyether-ether-ketone bone repair material with multi-scale holes. Small-size micro-nano holes obtained through sulfonation are beneficial to adhesion of early osteoblasts, large-size micro holes obtained through supercritical carbon dioxide foaming are beneficial to ingrowth of bone tissues in a later period, the material has a multi-scale hole structure through simple two-step operation, and bone repair is promoted. Compared with a hole-making technology using a hole-making agent, a supercritical carbon dioxide foaming technology does not have a problem that the hole-making agent is not thoroughly removed and the possibility that the material is applied to the field of biomedicine is ensured.
Owner:JILIN UNIV

Three dimensional porous cartilage template

This application relates to biologically compatible porous cartilage templates for in vitro and in vivo generation of bone with enhanced structural characteristics. Provided herein are compositions having an internal structure desirable for the generation and regeneration of bone, along with methods of preparation and use.
Owner:DREXEL UNIV

Highland barley health-care powder and preparation method thereof

The invention discloses highland barley health-care powder which is prepared from the raw materials of, by weight: 200-210 parts of highland barley, 30-40 parts of glutinous rice, 25-30 parts of corn, 20-25 parts of coix seed, 1-2 parts of immature Chinese holly tea, 2-3 parts of dwarf flowering cherry seed, 1-2 parts of Chinese photinia leaf, 1-2 parts of rhubarb, 1-3 parts of anise, 1-2 parts of obtuseleaf senna seed, 10-12 parts of cuttlefish bone, 3-5 parts of grape seed, 4-6 parts of brown sugar, 12-15 parts of potato, 1-2 parts of a food additive, and proper amount of water. According to the highland barley health-care powder, highland barley resource is effectively utilized, and can better meet the tastes of the mass. Highland barley has rich food and health-care values, comprises 18 amino acids including 8 amino acids needed by human bodies, comprises 12 trace elements such as copper, zinc, manganese, iron, potassium, calcium, magnesium, phosphorus, and the like, and has functions such as reducing blood fat, regulating blood sugar, preventing cancer, and the like. With the auxiliary of grains such as glutinous rice, corn, coix seed, and the like, taste and food of the health-care powder are supplemented to different extents. Also, with the added cuttlefish bone, functions such as eliminating dampness, stopping bleeding, resisting soreness, relieving pain, promoting bone damage reparation, resisting radiation, resisting tumor, resisting ulcer, and the like.
Owner:潘晓晨

Method for forming composite rhBMP-2 elasticity modulus graded porous titanium alloy support rod for femoral head and neck

The invention relates to a method for forming a composite rhBMP-2 elasticity modulus graded porous titanium alloy support rod for the femoral head and the neck. Titanium alloy powder is prepared with an electrode induction melting gas atomization method, and the integrated elasticity modulus graded porous titanium alloy support rod consisting of a head part, a body part and a tail part is prepared according to actually measured biomechanical parameters of the femoral head, the neck and a rotor, wherein the head part and the body part are prepared by sintering the titanium alloy powder and pore-forming agents through the adoption of a cold rolling method, the tail part is prepared by directly sintering the titanium alloy powder, and the porous titanium alloy support rod is immersed in a rhBMP-2 / gelatin controlled release microsphere solution. The product prepared by the method can simulate the biomechanical properties of the femoral head and the neck of a human body to the utmost extent, thereby being beneficial to the stress transfer between materials and bone tissue interfaces, avoiding poor bone restoration caused by the stress shielding effect; and simultaneously, sustained-release microspheres on which bone induced growth factors (rhBMP-2) are loaded endue the materials per se with good bone conductivity.
Owner:FOURTH MILITARY MEDICAL UNIVERSITY

Application of pilose antler peptide in promoting proliferation of mesenchymal stem cells

The invention belongs to the technical field of biological medicines, and discloses application of pilose antler peptide in promoting proliferation of mesenchymal stem cells. The pilose antler peptide which contains 32 amino acids obtained in the invention has an effect on proliferation of the ADSCs (Adipose Tissue-Derived Stromal Cells). The amino acid sequence of the pilose antler peptide is VLSATDKTNVLAAWGKVGGNAPAFGAEALERM. The pilose antler peptide has a most remarkable effect when the concentration of the pilose antler peptide is 20 ug / ml and the acting time is 48 hours, and is beneficial to promoting kidney damage repair and promoting skin wound healing and bone repair.
Owner:DALIAN UNIV OF TECH

Eucomman strontium complex and preparation method and application thereof

The invention relates to a eucomman strontium complex and a preparation method and application thereof. The preparation method of the eucomman strontium complex comprises the following steps: under the condition that the pH is controlled to be 9-11, eucomman and a water-soluble strontium salt react in water, and reaction liquid is obtained; and an organic precipitant is added into the reaction liquid, then a still standing reaction is conducted, then through solid-liquid separation, precipitates are collected, and thus the eucomman complex is obtained. The eucomman strontium complex is small in toxicity and has good bone repair and arthropathy prevention and treatment effects.
Owner:SOUTH UNIVERSITY OF SCIENCE AND TECHNOLOGY OF CHINA

Black phosphorus functionalized injectable hydrogel, preparation method and application thereof

The invention provides black phosphorus functionalized injectable hydrogel, and a preparation method and an application thereof. Black phosphorus quantum dots and a sodium alginate matrix are mixed byadopting an ionic crosslinking method, and then a calcium ion liquid is injected into a mixed liquid so that the mixed liquid is converted into a gel state from a liquid state in situ. BPQDs providedby the invention have a high infrared absorption capability and have a good photothermal effect, tumor cells can be effectively killed, the BPQDs can be subjected to an oxidative hydrolysis reactionunder an illumination effect, the obtained phosphorus ions have high safety and no toxicity on organisms, and a phosphorus source can be provided for biological mineralization of local cells so as topromote osteogenesis.
Owner:SICHUAN UNIV

Self-repairing injectable bone cement and preparation method

The invention discloses self-repairing injectable bone cement and a preparation method thereof. Solid powder of the self-repairing injectable bone cement contains inorganic calcium salt and is composited with formylated alginic acid or formylated alginic acid components, cured liquid contains water-soluble lysine-based polymers, and the self-repairing injectable bone cement is obtained by blending the cured liquid and the solid powder according to the liquid-solid ratio of 0.1 mL to 10 g. According to the self-repairing injectable bone cement material, amino groups and formyl groups are introduced to react to form imine bonds, a cross-linked network with the self-repairing property can be established, the mechanical strength and the collapse resistance property are improved, and meanwhile the good injection property can be reserved, so that the product has the good comprehensive property. By means of the good biocompatibility of lysine primitives and the degradability of the water-soluble lysine-based polymers and sodium alginate, adhesion, growth and proliferation of cells are facilitated, bone repair is facilitated, and ingrowth of the cells and blood vessels and bone tissue reconstruction are achieved.
Owner:闫策

Novel calcium magnesium silicate and silk fibroin composite porous scaffold and preparation method thereof

The invention discloses a novel calcium magnesium silicate and silk fibroin composite porous scaffold, and belongs to the technical field of preparation of bone defect repair medical materials, for solving the problem that the existing silk fibroin material is insufficient in osteoinduction and blood vessel forming property. The scaffold is composed of two materials including calcium magnesium silicate and silk fibroin, from the aspect of the natural bionic design, the inorganic and organic composite biological material with the porous structure is constructed by adopting the freeze drying technology, further, osteanagenesis is promoted, the flow is simple, the time needed by preparation is short, the needed materials are low in cost, the production cost is low, and the constitution and structure of the in-vivo human bone are simulated; and through the combination of the calcium magnesium silicate and silk fibroin, the mechanical strength of the composite porous scaffold is preferablyclose to the mechanical strength of the human cancellous bone, then a hydroxyapatite layer in good compatibility with the bone is formed, thus the effective osseointegration is formed, meanwhile, mechanical support is provided for the bone repair area, and further, the bone repair is promoted.
Owner:林泽枫

Magnesium-containing multiphase porous bioceramic

ActiveCN105582574ADegradableGood 3D interconnected mesh structureTissue regenerationProsthesisBone formationIn vivo
The invention discloses magnesium-containing multiphase porous bioceramic. The magnesium-containing multiphase porous bioceramic is obtained through calcination after a calcined bovine cancellous bone mineral porous scaffold dipped in a magnesium source-phosphorus source composite solution is dried. The material has excellent three-dimensional interconnected mesh structure, better mechanical strength and biodegradability and can release calcium, phosphorus, magnesium and other bone-formation beneficial ions; in the early stage of in-vivo transplantation of animals, repairing cells have excellent adhesion, proliferation, differentiation and bone matrix secretion in the three-dimensional porous structure of the transplantation material, bone repairing is good, and inflammatory reactions and immunological rejections are avoided in the observation period.
Owner:李亚屏

ZIF-8 drug-loaded hydrogel osteogenesis-promoting scaffold, preparation method and application

The invention belongs to the technical field of metal-organic frameworks, and discloses a ZIF-8 drug-loaded hydrogel osteogenesis-promoting scaffold, a preparation method and application, and the preparation method of the ZIF-8 drug-loaded hydrogel osteogenesis-promoting scaffold comprises the steps of construction of an SIM-ZIF-8 drug-loaded system and construction of the SIM-ZIF-8 / PEGDA / SA hydrogel. The novel ZIF-8 drug-loaded hydrogel osteogenesis-promoting scaffold is SIM-ZIF-8 / PEGDA / SA. According to the invention, an in-situ synthesis method is adopted to load SIM in a ZIF-8 pore structure (SIM-ZIF-8), and the biochemical microenvironment of bone tissues is improved, so that the dual effects of lowering lipid and forming bones are achieved. According to the invention, the ZIF-8 is loaded with an SIM small molecule drug for the first time, and the finally formed SIM-ZIF-8 system can reduce fat formation and promote osteogenesis under a high fat condition, and has a good application prospect in treatment of bone metabolic diseases caused by hyperlipidemia.
Owner:SICHUAN UNIV

Method for preparing composite micro-capsule with electrical stimulation response on surface of medical metal

InactiveCN107313092AIncrease loadFacilitate cell proliferation or differentiationProsthesisElectrolytic organic material coatingSide effectStem cell
The invention discloses a method for preparing a composite micro-capsule with the electrical stimulation response on the surface of medical metal and belongs to the technical field of biology materials. According to the method, an electrolytic solution prepared from a dopamine monomer, a conductive macromolecule monomer and medicine negatively charged is connected into a three-electrode electrochemical system, a medical metal material with a microsphere template array serves as a working electrode, the electrolytic solution is deposited on the surface of the medical metal to obtain a microsphere template wrapped by dopamine, conductive macromolecules and medicine in a compositing manner, and finally, after microspheres are dissolved completely, the medical metal material with the surface wrapped with the composite micro-capsule is prepared. According to the method, the surface of the medical metal material is modified, the functionality conduction composite micro-capsule is prepared on the surface of the medical metal material, the composite micro-capsule can control medicine release through electrical signal control and regulate stem cell differentiation directly through electrical signals, medicine stimulation and physical stimulation collaborate, dependence on the medicine and the side effect of the medicine are reduced, and the bone induction ability of medical metal is also improved.
Owner:SOUTHWEST JIAOTONG UNIV

Vascularized bone bionic multifunctional tissue engineering scaffold with anti-inflammatory effect and preparation method thereof

The invention discloses a vascularized bone bionic multifunctional tissue engineering scaffold with an anti-inflammatory effect and a preparation method thereof. The vascularized bone bionic multifunctional tissue engineering scaffold mainly comprises four components, namely an HA(at)PLA scaffold, GelMA, DFO-NPs and MnCO. An HA(at)PLA scaffold is prepared through a 3D printing technology and a surface coating manner, a mixed solution of GelMA prepolymer, MnCO and DFO-NPs is injected into the scaffold, UV photocrosslinking is performed to obtain the bionic multifunctional composite scaffold, and according to the bionic multifunctional composite scaffold prepared by combining the components, due to the release of MnCO and DFO-NPs, the bone repair can be well promoted by diminishing inflammation and promoting the formation of blood vessels, and a theoretical basis and technical support are provided for an existing clinical treatment scheme for large-segment bone defect repair.
Owner:FUZHOU UNIV

Carboxylated PEG derivative, hydrogel based on carboxylated PEG derivative as well as preparation methods and applications thereof

ActiveCN109912791AReduce intensityFacilitate adjustment of water swelling degreeProsthesisPolyethylene glycolHydroxy compound
The invention provides a carboxylated PEG derivative. The carboxylated PEG derivative is an ester which is obtained by carboxyl condensation of a hydroxyl-terminated and polycarboxylic acid polymer ofa linear or branched polyethylene glycol derivative; the structure of the carboxylated PEG derivative is shown in a formula (I), wherein X is a polycarboxylic acid polymer structure with side carboxyl, R is a core structure of the linear or branched polyethylene glycol derivative, n chooses 1-750, the value of m corresponds to the number of branched arms of the R and is an integer of 1-20. The invention further provides a PEG derivative active ester; the PEG derivative active ester is an ester after carboxyl of the carboxylated PEG derivative is activated by N-hydroxysuccinimide (NGS); the structure of the PEG derivative active ester is shown in the following formula (II); y-COOSu is a polycarboxylic acid polymer structure whose carboxyl is activated by NHS. The invention further providesa hydrogel composition prepared on the basis of the PEG derivative active ester and containing metal elements, a preparation method thereof and an application thereof in bone repair. The hydrogel composition provided by the invention has the advantages that multiple metal elements, such as calcium, magnesium or iron, and inorganic salts can be flexibly loaded or introduced; a breakthrough is madein the application of a hydrogel soft material in the bone repair field.
Owner:南京邦鼎生物科技有限公司

Bone repair material and preparation method and application thereof

The invention belongs to the field of biomedical materials, and particularly relates to a bone repair material and a preparation method and application of the bone repair material. According to the preparation method of the bone repair material provided by the invention, hydroxyapatite particles are uniformly wrapped in a collagenous fiber three-dimensional network by utilizing self-organization of the hydroxyapatite particles and collagen, and the bone repair material with a porous structure and a moldable characteristic is prepared. The bone repair material is high in mechanical strength and cannot be dispersed and broken in the use and transportation processes; and the bone repair material has good moldability, can be cut at will according to the shape of a defect area, becomes soft when encountering water, is rich in elasticity, is suitable for bone defect filling at any site, and plays the functions of bone filling and bone tissue regeneration guiding.
Owner:BEIJING BIOSIS HEALING BIOLOGICAL TECH

Bone repair scaffold with microelement-loaded coating and preparation method of bone repair scaffold

The invention relates to the technical field of medical materials, and particularly discloses a bone repair scaffold with a microelement-loaded coating and a preparation method of the bone repair scaffold. The bone repair scaffold comprises a porous ceramic scaffold body and a gelatin coating on the surface of the porous ceramic scaffold body; the gelatin coating contains microelements, wherein the microelements are selected from one or more of magnesium, copper, calcium, zinc, strontium and silicon. According to the bone repair scaffold, the microelement gelatin coating is loaded on the basis of the porous ceramic scaffold, so that the strength and toughness of the porous ceramic bone repair scaffold are improved, and the degradation rate of gelatin can be controlled by controlling the crosslinking degree of the gelatin and a crosslinking agent, and then, the release rate of the microelements is further controlled, which is conducive to osteogenesis and angiogenesis so that bone repair is further promoted. Furthermore, the different microelements are distributed at different positions of the gelatin coating, so that the microelements are released in sequence at different time, and the repair capability of bone repair at each time stage is promoted in a more targeting manner.
Owner:JIHUA LAB

Preparation method for zinc-doped hydroxyapatite fibroin composite membrane with bone facilitating function

The invention discloses a preparation method for a zinc-doped hydroxyapatite fibroin composite membrane with a bone facilitating function. The preparation method comprises the following steps: preparing a fibroin solution with concentration of 5%-25%, dropwise adding to a titanium plate electrode, after airing in natural conditions, processing by using ethyl alcohol, and performing Beta-hydroxylation, preparing an SF / Ti tablet, preparing mixed solution of calcium nitrate and ammonium dihydrogen phosphate as electrolyte, keeping a calcium-phosphorus ratio in a solution system to be 1.67, adding zinc nitrate with a certain concentration, adjusting a pH value to be 5-8 by using a NaOH solution. The preparation method is capable of, through good control of a fibroin membrane to hydroxyapatite, facilitating nucleus formation and growth of the hydroxyapatite in hydroxyapatite mineralized liquid, wherein the obtained hydroxyapatite in various forms expresses different biocompatibility and bone induction activity, bone repair is promoted, and a new idea for developing a fibroin bone tissue repairing material is provided.
Owner:ZHEJIANG UNIV

Preparation method of melt electrospun composite fiber scaffold for bone repair and anti-infection

The invention provides a preparation method of a melt electrospun composite fiber scaffold for bone repair and anti-infection. The preparation method comprises the following steps that (a) polycaprolactone, polyethylene glycol and macrolide antibiotics are mixed uniformly in an organic solvent, the organic solvent is evaporated and then is subjected to vacuum drying, and a solid mixed material isobtained; the mass ratio of the polycaprolactone to the polyethylene glycol to the macrolide antibiotics is 90 to (0.1-20) to (0.1-20); and (b) the solid mixed material obtained in the step (a) is subjected to melt electrospinning, and the melt electrospun composite fiber scaffold for the bone repair and anti-infection is obtained. Compared with the prior art, the preparation method can obtain a novel bone repair and anti-infective melt electrospun composite fiber scaffold which has an ordered structure and excellent biocompatibility, can be completely degraded, can be antibacterial, can promote bone cell proliferation, and meet the physical performance requirements, and the problems that a bone repair implant requires to be removed surgically twice and the bone implant is infected are solved.
Owner:GUANGDONG UNIV OF TECH

Sequential-release double-drug-loading hydrogel as well as preparation method and application thereof

The invention discloses sequential release double-drug-loading hydrogel, which is prepared by taking PBAE as a carrier material, loading vancomycin and forming the hydrogel with rhizoma drynariae general flavone nano-microspheres, and the material realizes sequential release of vancomycin and rhizoma drynariae general flavone, and has the advantages that the time sequence release of vancomycin and rhizoma drynariae general flavone is realized; and the two can play a synergistic effect to better promote the generation of osteoblasts, thereby having an application prospect in bone repair treatment.
Owner:WUHAN UNIV OF TECH

Vancomycin-loaded hydroxyapatite mesoporous bioglass composite material, preparation method and application

The invention relates to the field of medical materials, in particular to a vancomycin-loaded hydroxyapatite mesoporous bioglass composite material. The composite material takes a nano hydroxyapatitematerial as a carrier; the nano hydroxyapatite material is coated with a mesoporous bioglass sol material; pores of the mesoporous bioglass sol material is loaded with vancomycin. The composite material has better effects of promoting bone repair and resisting infection. On the one hand, the mesoporous bioglass component of the composite material can achieve stabilization and long-acting slow release of loaded antibiotics, so that bone repair is promoted; and on the other hand, by introduction of vancomycin, the composite material has anti-infection effect. Therefore, the problems that suddenrelease effect can be generated, the overall release is unstable and an implant does not have the function of promoting bone repair of the bone cement and vancomycin mixing method in the prior art aresolved.
Owner:SHANGHAI CHANGHAI HOSPITAL

An orthopedic adhesive capable of promoting bone growth and its preparation method

The invention discloses an orthopedic adhesive with the function of promoting bone growth and a preparation method thereof. The adhesive comprises the following raw materials in parts by weight: 40-60 parts of modified magnesium phosphate bone cement, 10-20 parts of nano-calcium carbonate 10-20 parts of sodium alginate, 1-3 parts of sodium selenite, 3-5 parts of pearl powder, 3-5 parts of medical stone, 5-10 parts of sodium polyacrylate, 1-3 parts of calcium lignosulfonate 1-3 parts of glycerin, 3-5 parts of chitosan, 3-5 parts of lecithin, 1-3 parts of Sapinberry saponin, 5-10 parts of gum arabic and 10-15 parts of collagen. The adhesive provided by the invention has the advantages of good cohesiveness, no side effects, good biocompatibility, good antibacterial properties, can promote callus growth, accelerate fracture healing, and has good water solubility, etc., and can meet clinical application requirements , suitable for orthopedics, spine surgery, osteoporosis treatment and fracture fixation and treatment.
Owner:GUANGXI UNIV

Bone repair material and its preparation method and application

The invention provides a bone repairing material, and a preparation method and application of the bone repairing material. The preparation method of the material comprises the steps: dissolving a structure directing agent and a pore-enlarging agent, adding a calcium source, a silicon source and a phosphorus source, adjusting a pH (potential of hydrogen) value to 9-11, placing for 56-80 h at 90-110 DEG C, baking for 6-10 h at 550-600 DEG C to form bioactivity glass, mixing the bioactivity glass and 3-aminopropyltriethoxysilane for 14-20 h, baking for 20-30 h at 80-150 DEG C, washing with chloroform, drying to form amino modified bioactivity glass, and incubating the amino modified bioactivity glass and a cell factor in a carbon dioxide incubator at 37 DEG C for 4-6 h to promote adsorption to form the bone repairing material. The material can promote osteoblast proliferation, osteogenesis direction differentiation and mineralization processes, has high cell compatibility and a good effect of promoting bone formation and has wide application prospects as the repairing material in a bone defect repairing process.
Owner:杭州维叶莫生物科技有限公司

A kind of n-ha/cs porous scaffold for bone repair and its preparation method and application

The invention discloses a n-HA / CS porous scaffold for bone repair and its preparation method and application. The bone repair scaffold uses the n-HA / CS porous scaffold as the basic structure, and the surface of the n-HA / CS porous scaffold is modified by dopamine A dopamine coating is formed, and chitosan microspheres cross-linked by glutaraldehyde are grafted on the surface of the dopamine coating. The n-HA / CS porous scaffold for bone repair of the present invention has simple raw material formula, safe ingredients, good biocompatibility, biodegradability, and the functions of promoting osteogenesis and vascularization, and can effectively promote osteogenesis in the process of bone defect reconstruction. At the same time, the surface-grafted CS microspheres can be loaded with drugs and growth factors, which provides a basis for further construction of a functional bone repair system that can perform local drug / growth factor controlled release.
Owner:SICHUAN UNIV

Material with antibacterial and osteogenesis promoting performance and preparation method thereof

The invention discloses a material with antibacterial and osteogenesis promoting properties and a preparation method thereof. The preparation method comprises the following steps: S1, respectively grinding gallium-loaded beta-calcium phosphate and Ca (H2PO4) 2. H2O powder; s2, weighing gallium-loaded beta-calcium phosphate and Ca (H2PO4) 2. H2O powder according to a molar ratio of 1: (0.9-1.1), mixing and grinding to obtain mixed powder; s3, adding calcium alginate microspheres loaded with acidic fibroblast growth factors into the mixture obtained in S2, grinding and uniformly mixing; s4, preparing a chitosan solution as a bone cement liquid phase; s5, stirring the mixed powder prepared in the step S3 and the solution prepared in the step S4 to obtain uniform slurry, and filling the uniform slurry into a mold; s6, after the material is solidified and demoulded, a product is obtained.The prepared material has the growth stimulating effect on osteoblasts, osteogenesis is facilitated, and the obvious inhibiting effect on growth of high-concentration bacteria can be achieved.
Owner:HENAN UNIV OF SCI & TECH

Desumab-loaded artificial bone and preparation method thereof

The invention discloses an artificial bone loaded with desumab and a preparation method of the artificial bone. The artificial bone is prepared from carboxymethyl chitosan powder, nano-hydroxyapatite powder, 2-methylimidazole zinc salt and desumab, the mass ratio of the carboxymethyl chitosan powder to the nano hydroxyapatite powder to the 2-methylimidazole zinc salt to the desumab is (2 to 4) to (2 to 4) to (0.05 to 0.2) to (0.12 to 0.72). The artificial bone can be used for treating the osteolytic bone tumor, and plays a biological effect by inhibiting postoperative bone defect local tumor recurrence and metastasis of the osteolytic bone tumor.
Owner:THE THIRD XIANGYA HOSPITAL OF CENT SOUTH UNIV

Method for constructing bone morphogenetic protein slow-release system

To solve the problem that an excellent carrier material is absent in a storage and use process of the bone morphogenetic protein, based on self-polymerization universality of dopamine, the positively-charged polyelectrolyte, the negatively-charged polyelectrolyte and the ceramic powder with biological activity are integrated onto the titanium base material in a layer-by-layer assembly mode to construct a bone morphogenetic protein slow-release system, so that long-acting slow release, on a lesion part, of the bone morphogenetic protein is achieved. The slow-release system has the advantages of being high in surface modulus, stable, resistant to radiation, good in biocompatibility, and the like, can effectively promote osteogenic differentiation of the mesenchymal stem cells, and can be expected to effectively promote bone repair.
Owner:THE 2ND AFFILIATED HOSPITAL & YUYING CHILDRENS HOSPITAL OF WENZHOU MEDICAL UNIV
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More