Heatstroke-resistant milk shake and preparation method thereof
A technology of heatstroke milk and milkshake, which is applied in the field of heatstroke prevention milkshake and its preparation, can solve the problems of ice cream with insignificant cooling effect, high fat content and calories, complex preparation process, etc., and achieve simple and novel process and control of the preparation process , The effect of easy preparation process
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Examples
Embodiment 1
[0015] The ingredients of the anti-heatstroke milkshake are calculated by weight: 500 parts of milk, 60 parts of plain yogurt, 4 parts of prebiotics, 40 parts of honey, 16 parts of ginger, and 28 parts of mung beans.
[0016] The anti-heat stroke milkshake includes pretreatment, sterilization, soaking, and stirring. The specific preparation steps are as follows:
[0017] 1) Pretreatment: Plain yogurt preparation: put fresh milk into a heating tank, add sugar, the solid-to-liquid ratio is 3:10, sterilize at 85°C-90°C for 40 minutes, cool to 40°C, add 30 parts by weight of milk 3 parts by weight of octenyl starch succinate, 15 parts by weight of Lactobacillus crispatus, and 1 part by weight of active polypeptide homogeneous, put it in a constant temperature incubator at 40-43°C for 10 minutes, and put it in a refrigerator at 2°C for 2.5 hours To obtain thick yogurt, the amino acid sequence of the active polypeptide is QSASCTLYGCYNLASDFASKFCGTAGCSLYGCYNLTPGKICYCLHCSR;
[0018] 2...
Embodiment 2
[0022] The ingredients of the anti-heatstroke milkshake are calculated by weight: 450 parts of milk, 550 parts of plain yogurt, 7 parts of prebiotics, 40 parts of honey, 18 parts of ginger, and 27 parts of mung beans.
[0023] The anti-heat stroke milkshake includes pretreatment, sterilization, soaking, and stirring. The specific preparation steps are as follows:
[0024] 1) Pretreatment: Preparation of plain yogurt: put fresh milk into a heating tank, add sugar, the solid-to-liquid ratio is 2.5:10, sterilize at 90°C for 38 minutes, cool to 39°C, add 21 parts by weight of milk, 2 parts by weight 15 parts by weight of octenyl starch succinate, 15 parts by weight of curly lactobacillus, 1 part by weight of homogeneous active polypeptide, put it in a constant temperature incubator at 40-43°C for fermentation for 10-20min, and put it in a refrigerator at 1-3°C for refrigeration 2-3h to get thick yogurt, the amino acid sequence of the active polypeptide is QSASCTLYGCYNLASDFASKFCGTA...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More