Chlorella polysaccharide

A technology of chlorella and chlorella powder, applied in the direction of anti-tumor drugs, food science, drug combination, etc., to achieve the effect of low production cost, simple extraction process, and excellent body immunity

Inactive Publication Date: 2018-01-12
兰溪市哥特生物技术有限公司
View PDF2 Cites 4 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

The raw material source of the invention is rich and cheap, and can be derived from the residue after oil production of chlorella, and the method is simple in process and low in production cost, and is a method for effectively improving the high added value and comprehensive utilization rate of chlorella, but the method There is still room for improvement in the yield of chlorella polysaccharides

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0019] A kind of chlorella polysaccharide, the extraction step of polysaccharide is:

[0020] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder and water is 1:40, add active peptides, the amount added is 0.04% of the weight of chlorella powder, the amino acid sequence of active peptides is QSGFCTSYYCSKFCGTAGSLYGNLTPGKICCLHCSS , using sodium phosphate buffer as the extractant, the pH of the sodium phosphate buffer is 7.1, at -20°C and 37°C, freeze-thaw 5 times, each 4h, ultrasonic treatment, ultrasonic power 500w, time is 10min, 8000r / min, centrifuge for 8min, take the supernatant to get the crude protein extract;

[0021] 2) Put the supernatant into a vacuum concentration tank and vacuum concentrate to 1 / 5 of the original volume. The vacuum concentration pressure is below -0.9Mpa. Add 85% ethanol solution to the concentrate, stir for 14 minutes, and centrifuge to obtain crude polysaccharides;

[0022] 3) To redissolve, add 20% trichl...

Embodiment 2

[0026] A kind of chlorella polysaccharide, the extraction step of polysaccharide is:

[0027] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is 1:38, add active polypeptide, the added amount is preferably 0.03% of the weight of chlorella powder, the amino acid sequence of the active polypeptide is QSGFCTSYYCSKFCGTAGSLYGNLTPGKICCLHCSS, choose sodium phosphate buffer as the extractant, the pH value of sodium phosphate buffer is preferably 7.0, freeze and thaw 5 times at -20°C and 37°C, each time 4h, ultrasonic treatment, the ultrasonic power is preferably 600w , the time is 10min, 7500r / min, centrifuge for 10min, get the supernatant to get the crude protein extract;

[0028] 2) Put the supernatant into a vacuum concentration tank and vacuum concentrate to 3 / 10 of the original volume. The vacuum concentration pressure is below -0.9Mpa. Add 90% ethanol solution to the concentrate, stir for 15 minutes, and centrifuge to obtain ...

Embodiment 3

[0033] A kind of chlorella polysaccharide, the extraction step of polysaccharide is:

[0034] 1) Take chlorella powder to make algae liquid, the solid-to-liquid ratio of chlorella powder to water is 1:47, add active peptides, the amount added is 0.05% of the weight of chlorella powder, the amino acid sequence of active peptides is QSGFCTSYYCSKFCGTAGSLYGNLTPGKICCLHCSS , using sodium phosphate buffer as the extractant, the pH of sodium phosphate buffer is 6.9, at -20°C and 37°C, freeze-thaw 4 times, each time 3.5h, ultrasonic treatment, ultrasonic power 450w, time 10min, 6000r / min, centrifuge for 12min, take the supernatant to obtain crude protein extract;

[0035] 2) Put the supernatant into a vacuum concentration tank to vacuum concentrate to 1 / 10 of the original volume, the vacuum concentration pressure is below -0.9Mpa, add 85% ethanol solution to the concentrate, stir for 20 minutes, and centrifuge to obtain crude polysaccharide;

[0036] 3) To redissolve, add 18% trichlor...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention provides a chlorella polysaccharide and belongs to the technical field of polysaccharide extraction. The extraction of the chlorella polysaccharide comprises the following steps: (1) preparing an alga solution by chlorella powder, adding an active polypeptide, selecting a sodium phosphate buffer solution as an extracting agent, repeatedly performing freezing and thawing, ultrasonic treatment and centrifuging, and taking supernate to obtain a crude protein extracting solution; (2) performing vacuum concentration on the supernate until the volume of the supernate is 1 / 10-3 / 10 of the volume of the supernate before the vacuum concentration, and performing alcohol precipitation and centrifuging to obtain a crude polysaccharide; (3) performing redissolving and removing proteins byusing a trichloroacetic acid method; and (4) performing vacuum concentration and freeze drying to obtain the chlorella polysaccharide. The extracted chlorella polysaccharide provided by the inventionhas excellent effects of promoting organism immunity and the resisting tumors and can be used in health care products. The extraction process of the chlorella polysaccharide is simple, the operabilityis high, and the production cost is low.

Description

technical field [0001] The invention belongs to the technical field of polysaccharide extraction, and in particular relates to a chlorella polysaccharide. Background technique [0002] Chlorella pyrenoidosa FACHBS is a kind of general unicellular algae. Chlorella has the advantages of wide ecological distribution, rapid growth and reproduction, and easy cultivation. It is the only organism among animals and plants on the earth that can grow 4 times in 20 hours, and has high application value. At present, chlorella has been widely used in animal feed, food additives, pharmaceutical preparations, beauty products, etc. Chlorella and its hot water extracts have the effects of promoting immunity and anti-tumor. A large number of experiments have proved that chlorella Among the active components of Chlorella, polysaccharides have the functions of promoting immunity and anti-tumor. The extraction of polysaccharides from Chlorella is generally carried out by hot water extraction, b...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C08B37/00A23L33/125A61P37/02A61P35/00
Inventor李健
Owner兰溪市哥特生物技术有限公司