High-density fermentation supplemented culture medium and fermentation technology of African swine fever genetic engineering vaccines
A genetic engineering vaccine, high-density fermentation technology, applied in the field of African swine fever genetic engineering vaccine high-density fermentation feed medium and fermentation technology, can solve the problem of low expression level and achieve the effect of increasing production
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0026] Example 1 Designing the amino acid sequence of African swine fever genetically engineered vaccine
[0027] Wherein, the African swine fever genetically engineered vaccine (fusion protein) includes at least the following amino acid fragments: at least one neutralizing antigenic epitope selected from p30 protein, at least one neutralizing antigenic epitope selected from p54 protein, and at least one neutralizing antigenic epitope selected from p72 At least one neutralizing antigenic epitope of the protein (the corresponding amino acid sequence can be the corresponding sequence listed in Chinese patent documents CN201911062920.5, CN201911052111.6 or CN201911052128.1).
[0028] In addition to the above-mentioned essential amino acid fragments, the African swine fever genetically engineered vaccine may also include T cell epitope peptides, such as p30 protein T cell epitope peptides, T lymphocyte activation epitope peptides (including but not limited to influenza virus NP pro...
Embodiment 2
[0032] Example 2 Construction of recombinant Escherichia coli
[0033] Submit the amino acid sequence of the African swine fever genetically engineered vaccine to be expressed to Sangon Bio (Shanghai) Co., Ltd., and the company will synthesize the nucleotide sequence encoding the African swine fever genetically engineered vaccine to be expressed according to the provided amino acid sequence (gene of interest), and the synthesized nucleotide sequence was cloned into a suitable plasmid vector pET28a. The plasmid containing the target gene was obtained and transferred to BL21 (DE3) to obtain recombinant Escherichia coli and placed in a -70°C strain tube (containing 75% glycerol) for future use.
[0034] Among them, the amino acid sequence of the African swine fever genetically engineered vaccine is:
[0035] TKPRKK MDSEFFQPVYPRHYGECLSPVTTPSFFSTHMYTIL GGGSGGG RRNIRFKPWFIPGVINEISLT NNELYINNLFVTPEIHNLFVKRVRFSLIRVHKTQ GGGSGGG NETNECTSSFETLFEQEPSSE KKTYQRTRALVGGGSGGGG
Embodiment 3
[0036] Example 3 High Density Fermentation of Recombinant Escherichia coli
[0037] 1.1 Recombinant E. coli culture
[0038] It is mainly divided into four stages: strain activation, seed culture, shake flask culture and fermenter culture.
[0039] 1.1.1 Activation of strains
[0040] Recombinant Escherichia coli strains are stored in -70°C strain tubes (containing 75% glycerol), and due to their low activity, they need to be transferred to slant medium and cultured overnight in a constant temperature incubator (37°C). Then, under the condition of 37°C and 225r / min, the strains were activated for 10 hours by shaking the flask twice, and then inoculated on a plate containing kanamycin and stored at 4°C.
[0041] 1.1.2 Seed Cultivation
[0042] Pick a single colony on the plate containing kanamycin with an inoculating loop, and transfer the strain to a sterilized 50 mL seed medium (LB liquid medium, each liter containing 10 g NaCl, 10 g peptone, 5g yeast powder, 0.02M pH7.4P...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 

